Sequences
EST Library Info
pigca2Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000183347 (click for geneview)
Transcript ID ENST00000332136(link to ensembl)
Symbol GBP6
Localtion Chromosome:1:89541638:89564040:1 band: 1p22.2
Description  
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--E--S--G--P--K--M--L--A--P--V--C--L--V--E--N--N--N--E--Q--L--L--V--N--Q--Q--A--I--Q--I--L--E--K--
ATGGAATCTGGACCCAAAATGTTGGCCCCCGTTTGCCTGGTGGAAAATAACAATGAGCAGCTATTGGTGAACCAGCAAGCTATACAGATTCTTGAAAAGA
:::: :::::::::::: ::: .:: ::::.:.::.:::.:..::::.:::::::::: :::.:..::::::::: ::::: :: :::: :::::.::::
ATGGCATCTGGACCCAACATGACGGACCCCATCTGTCTGATAAAAAACAACAATGAGCTGCTGTCAGTGAACCAGGAAGCTCTAGAGATACTTGAGAAGA
-M--A--S--G--P--N--M--T--D--P--I--C--L--I--K--N--N--N--E--L--L--S--V--N--Q--E--A--L--E--I--L--E--K--

-----------------------------------------------------------------------------------------><---------
I--S--Q--P--V--V--V--V--A--I--V--G--L--Y--R--T--G--K--S--Y--L--M--N--H--L--A--G--Q--N--H--G--F--P--L
TTTCTCAGCCAGTGGTGGTGGTGGCCATTGTAGGACTGTACCGTACAGGGAAATCCTACTTGATGAACCATCTGGCAGGACAGAATCATGGCTTCCCTCT
:::::::::: :::::::::::::::::::::::::::::.::.::::: :::::::::.:::::::::.::::::.::::::::.:::   :::: :::
TTTCTCAGCCCGTGGTGGTGGTGGCCATTGTAGGACTGTATCGCACAGGCAAATCCTACCTGATGAACCGTCTGGCGGGACAGAACCAT---TTCCGTCT
I--S--Q--P--V--V--V--V--A--I--V--G--L--Y--R--T--G--K--S--Y--L--M--N--R--L--A--G--Q--N--H-----F--R--L

----------------------------------------------------------------------------------------------------
--G--S--T--V--Q--S--E--T--K--G--I--W--M--W--C--V--P--H--P--S--K--P--N--H--T--L--V--L--L--D--T--E--G-
GGGCTCCACGGTGCAGTCTGAAACCAAGGGCATCTGGATGTGGTGCGTGCCCCACCCATCCAAGCCAAACCACACCCTGGTCCTTCTGGACACCGAAGGT
::: :::::.:::::::::::::::::::::::::::::::::::.::::::::::: :::::::::.::::::.:::::::::::::::::::::.::.
GGGGTCCACAGTGCAGTCTGAAACCAAGGGCATCTGGATGTGGTGTGTGCCCCACCCCTCCAAGCCAGACCACATCCTGGTCCTTCTGGACACCGAGGGC
--G--S--T--V--Q--S--E--T--K--G--I--W--M--W--C--V--P--H--P--S--K--P--D--H--I--L--V--L--L--D--T--E--G-

-----------------><---------------------------------------------------------------------------------
-L--G--D--V--E--K--G--D--P--K--N--D--S--W--I--F--A--L--A--V--L--L--C--S--T--F--V--Y--N--S--M--S--T--
CTGGGCGATGTGGAAAAGGGTGACCCTAAGAATGACTCCTGGATCTTTGCCCTGGCTGTGCTCCTGTGCAGCACCTTTGTCTACAACAGCATGAGCACCA
::::::::::::::.:::::.:::.:.::::::::::: ::::::::.::::::::.:::::.::: :::::..:::.::::::::::::::::.:::::
CTGGGCGATGTGGAGAAGGGCGACTCCAAGAATGACTCGTGGATCTTCGCCCTGGCCGTGCTTCTGAGCAGCGTCTTCGTCTACAACAGCATGAACACCA
-L--G--D--V--E--K--G--D--S--K--N--D--S--W--I--F--A--L--A--V--L--L--S--S--V--F--V--Y--N--S--M--N--T--

---------------------------><-----------------------------------------------------------------------
I--N--H--Q--A--L--E--Q--L--H--Y--V--T--E--L--T--E--L--I--K--A--K--S--S--P--R--P--D--G--V--E--D--S--T
TCAACCACCAGGCCCTGGAGCAGCTGCATTATGTGACGGAGCTCACAGAACTAATTAAGGCAAAGTCCTCCCCAAGGCCTGATGGAGTAGAAGATTCCAC
::::::::::::::::::::::::::   ::::::::.::::::::.::.:: ::.:.:.: :::::::: .::...  .::::::::.::.::.: :::
TCAACCACCAGGCCCTGGAGCAGCTG---TATGTGACAGAGCTCACGGAGCTCATCAGGACCAAGTCCTCGTCAGAAAACGATGGAGTGGAGGACTGCAC
I--N--H--Q--A--L--E--Q--L-----Y--V--T--E--L--T--E--L--I--R--T--K--S--S--S--E--N--D--G--V--E--D--C--T

----------------------------------------------------------------------------------------------------
--E--F--V--S--F--F--P--D--F--L--W--T--V--R--D--F--T--L--E--L--K--L--N--G--H--P--I--T--E--D--E--Y--L-
AGAGTTTGTGAGTTTCTTCCCAGACTTTCTTTGGACAGTACGGGATTTCACTCTGGAGCTGAAGTTGAACGGTCACCCTATCACAGAAGATGAATACCTG
.:::::::::::::::::.::::::::: :.::::. :: :::::::::::.::::: ::::::::: :.:::::::::.:::::::.:::::.::::::
GGAGTTTGTGAGTTTCTTTCCAGACTTTATCTGGATTGTTCGGGATTTCACCCTGGACCTGAAGTTGCATGGTCACCCTGTCACAGAGGATGAGTACCTG
--E--F--V--S--F--F--P--D--F--I--W--I--V--R--D--F--T--L--D--L--K--L--H--G--H--P--V--T--E--D--E--Y--L-

------------------------><--------------------------------------------------------------------------
-E--N--A--L--K--L--I--Q--G--N--N--P--R--V--Q--T--S--N--F--P--R--E--C--I--R--R--F--F--P--K--R--K--C--
GAGAATGCCTTGAAGCTGATTCAAGGCAATAATCCCAGAGTTCAAACATCCAATTTTCCCAGGGAGTGCATCAGGCGTTTCTTTCCAAAACGGAAGTGTT
:::::::::::::::::::::      ::::::::::.::..:.::.:::::::.: :::::.:::::::::::::.::::::.::::::::::::::::
GAGAATGCCTTGAAGCTGATT------AATAATCCCAAAGCCCGAATATCCAATCTACCCAGAGAGTGCATCAGGCATTTCTTCCCAAAACGGAAGTGTT
-E--N--A--L--K--L--I--------N--N--P--K--A--R--I--S--N--L--P--R--E--C--I--R--H--F--F--P--K--R--K--C--

----------------------------------------------------------------------------------------------------
F--V--F--D--R--P--T--N--D--K--D--L--L--A--N--I--E--K--V--S--E--K--Q--L--D--P--K--F--Q--E--Q--T--N--I
TCGTCTTTGACCGGCCAACAAATGACAAAGACCTTCTAGCCAATATTGAGAAGGTGTCAGAAAAGCAACTGGATCCCAAATTCCAGGAACAAACAAACAT
:.:::::::::::.:::::: ::::::::::.::.::.:::::::::::::: :::::.:: .: :::::::::::.:::::::::::::::.:::::: 
TTGTCTTTGACCGACCAACACATGACAAAGATCTCCTGGCCAATATTGAGAATGTGTCGGACGACCAACTGGATCCTAAATTCCAGGAACAAGCAAACAA
F--V--F--D--R--P--T--H--D--K--D--L--L--A--N--I--E--N--V--S--D--D--Q--L--D--P--K--F--Q--E--Q--A--N--N

----------------------------------------------------------------------><----------------------------
--F--C--S--Y--I--F--T--H--A--R--T--K--T--L--R--E--G--I--T--V--T--G--N--R--L--G--T--L--A--V--T--Y--V-
TTTCTGTTCTTACATCTTCACTCATGCAAGAACCAAGACCCTCAGGGAGGGAATCACAGTCACTGGGAATCGTCTGGGAACTCTGGCAGTGACTTATGTA
.::::::::.:::::::::::. ::::::..:::::::: :::::.:: ::::::::::::..::::      :::: :.::::::..: ::: ::. ::
CTTCTGTTCCTACATCTTCACCAATGCAAAGACCAAGACGCTCAGAGATGGAATCACAGTCGTTGGG------CTGGCAGCTCTGGTGGAGACATACCTA
--F--C--S--Y--I--F--T--N--A--K--T--K--T--L--R--D--G--I--T--V--V--G--------L--A--A--L--V--E--T--Y--L-

----------------------------------------------------------------------------------------------------
-E--A--I--N--S--G--A--V--P--C--L--E--N--A--V--I--T--L--A--Q--R--E--N--S--A--A--V--Q--R--A--A--D--Y--
GAGGCCATCAACAGTGGAGCAGTGCCTTGTCTGGAGAATGCAGTGATAACTCTGGCCCAGCGTGAGAACTCAGCGGCCGTGCAGAGGGCAGCTGACTACT
::.::::::::::::::::  :: ::::::::::::::.::::::.::::.::::::::.::.:::::: :::::::::::::::.::::::.:::. ::
GAAGCCATCAACAGTGGAGACGTTCCTTGTCTGGAGAACGCAGTGGTAACCCTGGCCCAACGCGAGAACGCAGCGGCCGTGCAGAAGGCAGCCGACCTCT
-E--A--I--N--S--G--D--V--P--C--L--E--N--A--V--V--T--L--A--Q--R--E--N--A--A--A--V--Q--K--A--A--D--L--

----------------------------------------------------------------------------------------------------
Y--S--Q--Q--M--A--Q--R--V--K--L--P--T--D--T--L--Q--E--L--L--D--M--H--A--A--C--E--R--E--A--I--A--I--F
ACAGCCAGCAGATGGCCCAGCGAGTGAAGCTCCCCACAGACACGCTCCAGGAGCTGCTGGACATGCATGCGGCCTGTGAGAGGGAAGCCATTGCAATCTT
::::: : :.::::::::.:: : :::. ::::::::::::::::::: :::::::::::: .::::.::::::::.::::.:::.::::::::..::::
ACAGCGATCGGATGGCCCGGCTACTGAGCCTCCCCACAGACACGCTCCTGGAGCTGCTGGAGGTGCACGCGGCCTGCGAGAAGGAGGCCATTGCGGTCTT
Y--S--D--R--M--A--R--L--L--S--L--P--T--D--T--L--L--E--L--L--E--V--H--A--A--C--E--K--E--A--I--A--V--F

---------------------------------------------------><-----------------------------------------------
--M--E--H--S--F--K--D--E--N--Q--E--F--Q--K--K--F--M--E--T--T--M--N--K--K--G--D--F--L--L--Q--N--E--E-
CATGGAGCACTCCTTCAAGGATGAAAATCAGGAATTCCAGAAGAAGTTCATGGAAACCACAATGAATAAGAAGGGGGATTTCTTGCTGCAGAATGAAGAG
:::::::                                             ::::.::.:: :::::::::::.::.:::: :::::::::::::::::
CATGGAG---------------------------------------------GAAATCATAAAGAATAAGAAGGAGGGTTTCGTGCTGCAGAATGAAGAG
--M--E-----------------------------------------------E--I--I--K--N--K--K--E--G--F--V--L--Q--N--E--E-

----------------------------------------------------------------------------------------------------
-S--S--V--Q--Y--C--Q--A--K--L--N--E--L--S--K--G--L--M--E--S--I--S--A--G--S--F--S--V--P--G--G--H--K--
TCATCTGTTCAATACTGCCAGGCTAAACTCAATGAGCTCTCAAAGGGACTAATGGAAAGTATCTCAGCAGGAAGTTTCTCTGTTCCTGGAGGGCACAAGC
 ::::::.. ::::::::::::  :::::..:: ::::.::::::.  ::::::.::.::::.:: :::::::  ::::::::::::::::: ::..:.:
GCATCTGCCAAATACTGCCAGGAAAAACTTGATCAGCTTTCAAAGACCCTAATGAAAGGTATTTCTGCAGGAATGTTCTCTGTTCCTGGAGGCCATGAAC
-A--S--A--K--Y--C--Q--E--K--L--D--Q--L--S--K--T--L--M--K--G--I--S--A--G--M--F--S--V--P--G--G--H--E--

----------------------------------------------------------------><----------------------------------
L--Y--M--E--T--K--E--R--I--E--Q--D--Y--W--Q--V--P--R--K--G--V--K--A--K--E--V--F--Q--R--F--L--E--S--Q
TCTACATGGAAACAAAGGAAAGGATTGAACAGGACTATTGGCAAGTTCCCAGGAAAGGAGTAAAGGCAAAAGAGGTCTTCCAGAGGTTCCTGGAGTCACA
:::::: :..:.:::::. ::.: :::::  ::: ::::: ::::: ::::::::::::::::::                                   
TCTACAGGAGAGCAAAGACAAAGCTTGAAATGGAGTATTGCCAAGTGCCCAGGAAAGGAGTAAAG-----------------------------------
L--Y--R--R--A--K--T--K--L--E--M--E--Y--C--Q--V--P--R--K--G--V--K------------------------------------

-------------------------------------------------------------------><-------------------------------
--M--V--I--E--E--S--I--L--Q--S--D--K--A--L--T--D--R--E--K--A--V--A--V--D--R--A--K--K--E--A--A--E--K-
GATGGTGATAGAGGAATCCATCTTGCAGTCAGATAAAGCCCTCACTGATAGAGAGAAGGCAGTAGCAGTGGATCGGGCCAAGAAGGAGGCAGCTGAGAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-E--Q--E--L--L--K--Q--K--L--Q--E--Q--Q--Q--Q--M--E--A--Q--D--K--S--R--K--E--N--I--A--Q--L--K--E--K--
GAACAGGAACTTTTAAAACAGAAATTACAGGAGCAGCAGCAACAGATGGAGGCTCAAGATAAGAGTCGCAAGGAAAACATAGCCCAACTGAAGGAGAAGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------><-------------------------------------
L--Q--M--E--R--E--H--L--L--R--E--Q--I--M--M--L--E--H--T--Q--K--V--Q--N--D--W--L--H--E--G--F--K--K--K
TGCAGATGGAGAGAGAACACCTACTGAGAGAGCAGATTATGATGTTGGAGCACACGCAGAAGGTCCAAAATGATTGGCTTCATGAAGGATTTAAGAAGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--Y--E--E--M--N--A--E--I--S--Q--F--K--R--M--I--D--T--T--K--N--D--D--T--P--W--I--A--R--T--L--D--N--L-
GTATGAGGAGATGAATGCAGAGATAAGTCAATTTAAACGTATGATTGATACTACAAAAAATGATGATACTCCCTGGATTGCACGAACCTTGGACAACCTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-A--D--E--L--T--A--I--L--S--A--P--A--K--L--I--G--H--G--V--K--G--V--S--S--L--F--K--K--H--K--L--P--F--
GCCGATGAGCTAACTGCAATATTGTCTGCTCCTGCTAAATTAATTGGTCATGGTGTCAAAGGTGTGAGCTCACTCTTTAAAAAGCATAAGCTCCCCTTTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

->
*-
AA
  
--
--

Pig Consensus Sequence

>BGISUST0000878649
ATGGCATCTGGACCCAACATGACGGACCCCATCTGTCTGATAAAAAACAACAATGAGCTGCTGTCAGTGAACCAGGAAGCTCTAGAGATACTTGAGAAGA
TTTCTCAGCCCGTGGTGGTGGTGGCCATTGTAGGACTGTATCGCACAGGCAAATCCTACCTGATGAACCGTCTGGCGGGACAGAACCAT---TTCCGTCT
GGGGTCCACAGTGCAGTCTGAAACCAAGGGCATCTGGATGTGGTGTGTGCCCCACCCCTCCAAGCCAGACCACATCCTGGTCCTTCTGGACACCGAGGGC
CTGGGCGATGTGGAGAAGGGCGACTCCAAGAATGACTCGTGGATCTTCGCCCTGGCCGTGCTTCTGAGCAGCGTCTTCGTCTACAACAGCATGAACACCA
TCAACCACCAGGCCCTGGAGCAGCTG---TATGTGACAGAGCTCACGGAGCTCATCAGGACCAAGTCCTCGTCAGAAAACGATGGAGTGGAGGACTGCAC
GGAGTTTGTGAGTTTCTTTCCAGACTTTATCTGGATTGTTCGGGATTTCACCCTGGACCTGAAGTTGCATGGTCACCCTGTCACAGAGGATGAGTACCTG
GAGAATGCCTTGAAGCTGATT------AATAATCCCAAAGCCCGAATATCCAATCTACCCAGAGAGTGCATCAGGCATTTCTTCCCAAAACGGAAGTGTT
TTGTCTTTGACCGACCAACACATGACAAAGATCTCCTGGCCAATATTGAGAATGTGTCGGACGACCAACTGGATCCTAAATTCCAGGAACAAGCAAACAA
CTTCTGTTCCTACATCTTCACCAATGCAAAGACCAAGACGCTCAGAGATGGAATCACAGTCGTTGGG------CTGGCAGCTCTGGTGGAGACATACCTA
GAAGCCATCAACAGTGGAGACGTTCCTTGTCTGGAGAACGCAGTGGTAACCCTGGCCCAACGCGAGAACGCAGCGGCCGTGCAGAAGGCAGCCGACCTCT
ACAGCGATCGGATGGCCCGGCTACTGAGCCTCCCCACAGACACGCTCCTGGAGCTGCTGGAGGTGCACGCGGCCTGCGAGAAGGAGGCCATTGCGGTCTT
CATGGAG---------------------------------------------GAAATCATAAAGAATAAGAAGGAGGGTTTCGTGCTGCAGAATGAAGAG
GCATCTGCCAAATACTGCCAGGAAAAACTTGATCAGCTTTCAAAGACCCTAATGAAAGGTATTTCTGCAGGAATGTTCTCTGTTCCTGGAGGCCATGAAC
TCTACAGGAGAGCAAAGACAAAGCTTGAAATGGAGTATTGCCAAGTGCCCAGGAAAGGAGTAAAG-----------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--


>BGISUSP0000878649
MASGPNMTDPICLIKNNNELLSVNQEALEILEKISQPVVVVAIVGLYRTGKSYLMNRLAGQNH-FRLGSTVQSETKGIWMWCVPHPSKPDHILVLLDTEG
LGDVEKGDSKNDSWIFALAVLLSSVFVYNSMNTINHQALEQL-YVTELTELIRTKSSSENDGVEDCTEFVSFFPDFIWIVRDFTLDLKLHGHPVTEDEYL
ENALKLI--NNPKARISNLPRECIRHFFPKRKCFVFDRPTHDKDLLANIENVSDDQLDPKFQEQANNFCSYIFTNAKTKTLRDGITVVG--LAALVETYL
EAINSGDVPCLENAVVTLAQRENAAAVQKAADLYSDRMARLLSLPTDTLLELLEVHAACEKEAIAVFME---------------EIIKNKKEGFVLQNEE
ASAKYCQEKLDQLSKTLMKGISAGMFSVPGGHELYRRAKTKLEMEYCQVPRKGVK---------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------