Sequences
EST Library Info
cly1Lymph - RNA from China
nje1Newborn 115 days, jejunum
sme1M. Semimembranosus
ton1Tip of tongue, mucosal membrane
Clusters
Oligos
SNPs

Gene ID ENSG00000066379 (click for geneview)
Transcript ID ENST00000332435(link to ensembl)
Symbol ZNRD1
Localtion Chromosome:6:30137015:30140664:1 band: 6p21.33
Description zinc ribbon domain containing, 1 [Source:RefSeq_peptide;Acc:NP_055411]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--V--M--D--L--A--N--T--C--S--S--F--Q--S--D--L--D--F--C--S--D--C--G--S-----V--L--P--L--P--G--A--
ATGTCTGTCATGGACCTCGCCAATACTTGCTCCAGCTTTCAGTCGGACCTGGATTTCTGTTCAGATTGCGGCTCG---GTCCTGCCTCTGCCCGGGGCTC
         :::::::::::: ..:: : :::.:::::::::::::::::::::::::::.:.::::::::::::   ::::::::::::::::::.:::
---------ATGGACCTCGCCCGCACATCCTCTAGCTTTCAGTCGGACCTGGATTTCTGTCCGGATTGCGGCTCGT--GTCCTGCCTCTGCCCGGGACTC
----------M--D--L--A--R--T--S--S--S--F--Q--S--D--L--D--F--C--P--D--C--G--S--\--V--L--P--L--P--G--T--

-----------------------------------------------><---------------------------------------------------
Q--D--T--V--T--C--I--R--C--G--F--N--I--N--V--R--D--F--E--G--K--V--V--K--T--S--V--V--F--H--Q--L--G--T
AGGATACGGTCACCTGTATTCGCTGTGGCTTCAACATCAACGTTCGGGACTTTGAGGGGAAGGTTGTGAAGACTTCGGTTGTGTTCCACCAACTGGGGAC
:::::.::::::..::::.:::::::::::::  ::::::::: :::   :::::::::::::::::::::::.::.:::::::::::  :: :::::::
AGGATGCGGTCATTTGTACTCGCTGTGGCTTCTCCATCAACGTGCGG---TTTGAGGGGAAGGTTGTGAAGACCTCAGTTGTGTTCCAGAAAGTGGGGAC
Q--D--A--V--I--C--T--R--C--G--F--S--I--N--V--R-----F--E--G--K--V--V--K--T--S--V--V--F--Q--K--V--G--T

------------------------------------------------><--------------------------------------------------
--A--M--P--M--S--V--E--E--G--P--E--C--Q--G--P--V--V--D--R--R--C--P--R--C--G--H--E--G--M--A--Y--H--T-
AGCCATGCCTATGTCGGTGGAGGAAGGGCCTGAGTGCCAGGGACCTGTGGTTGACAGGCGCTGCCCTCGATGTGGTCATGAAGGAATGGCATACCACACC
::::::::::::::::.::::::::::.::::::: :::::::::.:::::::::::::::::.::::: :::::::::::.::::::::::::::::::
AGCCATGCCTATGTCGATGGAGGAAGGACCTGAGTTCCAGGGACCCGTGGTTGACAGGCGCTGTCCTCGTTGTGGTCATGAGGGAATGGCATACCACACC
--A--M--P--M--S--M--E--E--G--P--E--F--Q--G--P--V--V--D--R--R--C--P--R--C--G--H--E--G--M--A--Y--H--T-

----------------------------------------------------------><----------------------->
-R--Q--M--R--S--A--D--E--G--Q--T--V--F--Y--T--C--T--N--C--K--F--Q--E--K--E--D--S--*-
AGACAGATGCGTTCAGCCGATGAAGGGCAAACTGTCTTCTACACCTGTACCAACTGCAAGTTCCAGGAGAAGGAAGACTCTTGA
:::::: ::::.:::::::::::::::::.:::::::::::::::::::::::::::                           
AGACAGTTGCGCTCAGCCGATGAAGGGCAGACTGTCTTCTACACCTGTACCAACTGC---------------------------
-R--Q--L--R--S--A--D--E--G--Q--T--V--F--Y--T--C--T--N--C----------------------------

Pig Consensus Sequence

>BGISUST0000888897
---------ATGGACCTCGCCCGCACATCCTCTAGCTTTCAGTCGGACCTGGATTTCTGTCCGGATTGCGGCTCggTCCTGCCTCTGCCCGGGACTCAGG
ATGCGGTCATTTGTACTCGCTGTGGCTTCTCCATCAACGTGCGG---TTTGAGGGGAAGGTTGTGAAGACCTCAGTTGTGTTCCAGAAAGTGGGGACAGC
CATGCCTATGTCGATGGAGGAAGGACCTGAGTTCCAGGGACCCGTGGTTGACAGGCGCTGTCCTCGTTGTGGTCATGAGGGAATGGCATACCACACCAGA
CAGTTGCGCTCAGCCGATGAAGGGCAGACTGTCTTCTACACCTGTACCAACTGC---------------------------


>BGISUSP0000888897
---MDLARTSSSFQSDLDFCPDCGSVLPLPGTQDAVICTRCGFSINVR-FEGKVVKTSVVFQKVGTAMPMSMEEGPEFQGPVVDRRCPRCGHEGMAYHTR
QLRSADEGQTVFYTCTNC---------