Sequences
EST Library Info
cje1Jejunum - RNA from China
cly2Lymph - RNA from China
cut1Uterus - RNA from China
mgm1Mammary gland - 14 days after birth
nco1Newborn 115 days, colon
nep1Newborn 115 days, epidermis
pgl2Pituitary gland
ski1Skin
Clusters
Oligos
SNPs

Gene ID ENSG00000183899 (click for geneview)
Transcript ID ENST00000332726(link to ensembl)
Localtion Chromosome:15:19941764:19942210:-1 band: 15q11.2
Description  
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--D--I--S--W--D--N--W--H--K--C--H--K--T--R--D--K--R--K--P--Y--H--K--K--R--K--Y--E--L--G--H--P--A--
ATGGACATCTCTTGGGACAACTGGCACAAGTGCCACAAAACCAGGGACAAGAGAAAGCCCTACCACAAGAAGCGGAAGTATGAGTTGGGGCACCCAGCTG
::::.:::::::.:::::::::::::::::.:::.:::.::..:::.:::::::::::::::::::::::::::::::::::::.::::.:.::: ::::
ATGGGCATCTCTCGGGACAACTGGCACAAGCGCCGCAAGACTGGGGGCAAGAGAAAGCCCTACCACAAGAAGCGGAAGTATGAGCTGGGACGCCCCGCTG
-M--G--I--S--R--D--N--W--H--K--R--R--K--T--G--G--K--R--K--P--Y--H--K--K--R--K--Y--E--L--G--R--P--A--

----------------------------------------------------------------------------------------------------
A--N--T--K--T--G--P--R--R--I--H--T--V--R--V--W--G--G--N--K--K--Y--C--A--L--R--L--D--V--R--N--F--S--W
CCAACACCAAGACTGGCCCCCGCCGCATCCACACAGTCCGTGTGTGGGGAGGTAACAAGAAATACTGTGCCCTGAGGCTGGACGTGAGGAATTTCTCCTG
: ::::::::::.::::::.:::::::: :::::::::::::::.::::::::::::::::.:::.: :::.::::::::::::::.::::.::::::::
CAAACACCAAGATTGGCCCTCGCCGCATACACACAGTCCGTGTGCGGGGAGGTAACAAGAAGTACCGGGCCTTGAGGCTGGACGTGGGGAACTTCTCCTG
A--N--T--K--I--G--P--R--R--I--H--T--V--R--V--R--G--G--N--K--K--Y--R--A--L--R--L--D--V--G--N--F--S--W

----------------------------------------------------------------------------------------------------
--G--S--E--C--C--A--H--K--T--T--I--I--D--V--V--Y--N--A--S--N--N--E--L--V--R--P--K--T--L-----V--K--N-
GGGCTCAGAATGTTGTGCTCATAAAACAACGATCATCGATGTTGTCTACAATGCATCTAATAACGAGCTGGTTCGTCCCAAGACCCTG---GTGAAGAAT
:::::: ::.:::::..: :. ::.::.: :::.::.::.::::: :::::.:::::.::.::.::.:::::.::: :::::::::::    :::::::.
GGGCTCCGAGTGTTGCACACGAAAGACGAGGATTATTGACGTTGTGTACAACGCATCCAACAATGAACTGGTCCGTACCAAGACCCTGG--CTGAAGAAC
--G--S--E--C--C--T--R--K--T--R--I--I--D--V--V--Y--N--A--S--N--N--E--L--V--R--T--K--T--L--\--V--K--N-

----------------------------------------------------------------------------------------------------
-C--I--V--L--I--D--S--T--L--Y--R--Q--W--Y--E--S--H--Y--A--P--P--L--G--C--K--K--G--A--K--L--T--P--E--
TGCATTGTGCTCATTGACAGCACACTGTACCGACAGTGGTACGAGTCCCACTATGCGCCGCCCCTGGGCTGCAAGAAGGGAGCCAAGCTGACTCCTGAGG
::::::::::::::::::::::: :.:::.:::::::::::::::::::::::.::::.:::::::::..::::::::::.::::::.::::::::::::
TGCATTGTGCTCATTGACAGCACCCCGTATCGACAGTGGTACGAGTCCCACTACGCGCTGCCCCTGGGTCGCAAGAAGGGGGCCAAGTTGACTCCTGAGG
-C--I--V--L--I--D--S--T--P--Y--R--Q--W--Y--E--S--H--Y--A--L--P--L--G--R--K--K--G--A--K--L--T--P--E--

---------------------------------------------------->
E--E--E--I--L-----N--K--K--R--S--K--K--I--Q--K--K--Y-
AAGAAGAGATTTTG---AACAAAAAGCGATCTAAAAAAATTCAGAAGAAATAT
:.:::::::::::.    ::::::::::::: ::.::::::::::::::.:::
AGGAAGAGATTTTAA--CACAAAAAGCGATCAAAGAAAATTCAGAAGAAGTAT
E--E--E--I--L--\--N--K--K--R--S--K--K--I--Q--K--K--Y-

Pig Consensus Sequence

>BGISUST0000891164
ATGGGCATCTCTCGGGACAACTGGCACAAGCGCCGCAAGACTGGGGGCAAGAGAAAGCCCTACCACAAGAAGCGGAAGTATGAGCTGGGACGCCCCGCTG
CAAACACCAAGATTGGCCCTCGCCGCATACACACAGTCCGTGTGCGGGGAGGTAACAAGAAGTACCGGGCCTTGAGGCTGGACGTGGGGAACTTCTCCTG
GGGCTCCGAGTGTTGCACACGAAAGACGAGGATTATTGACGTTGTGTACAACGCATCCAACAATGAACTGGTCCGTACCAAGACCCTgcTGAAGAACTGC
ATTGTGCTCATTGACAGCACCCCGTATCGACAGTGGTACGAGTCCCACTACGCGCTGCCCCTGGGTCGCAAGAAGGGGGCCAAGTTGACTCCTGAGGAGG
AAGAGATTTTacACAAAAAGCGATCAAAGAAAATTCAGAAGAAGTAT


>BGISUSP0000891164
MGISRDNWHKRRKTGGKRKPYHKKRKYELGRPAANTKIGPRRIHTVRVRGGNKKYRALRLDVGNFSWGSECCTRKTRIIDVVYNASNNELVRTKTLLKNC
IVLIDSTPYRQWYESHYALPLGRKKGAKLTPEEEEILHKKRSKKIQKKY