Sequences
EST Library Info
cov1Ovary - RNA from China
Clusters
Oligos
SNPs

Gene ID ENSG00000183356 (click for geneview)
Transcript ID ENST00000332888(link to ensembl)
Localtion Chromosome:11:118978782:118980103:-1 band: 11q23.3
Description  
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-G--S--S--S--F--R--G--G--L--G--R--G--Y--G--G--A--S--G--I-----G--G--I--T--T--V--T--V--N--Q--S--L--L--
GGCAGCAGCAGCTTCCGGGGTGGCCTGGGCAGAGGCTATGGTGGGGCCAGCGGCATA---GGAGGCATCACCACTGTCACGGTCAACCAGAGCCTGCTGA
                                 ::.::.:::::: ::   ::: :.    :::::::::: .:::::::.:: ::::::::::::::::
---------------------------------GGTTACGGTGGGCCCTCAGGCTTGG--TGAGGCATCACAGCTGTCACAGTGAACCAGAGCCTGCTGA
----------------------------------G--Y--G--G--P--S--G--L--\--G--G--I--T--A--V--T--V--N--Q--S--L--L--

----------------------------------------------------------------------------------------------------
S--P--L--N--L--E--V--D--P--N--I--Q--A-----V--R--T-----Q--E--K--E--Q--I--K--T--L--N--N--K--F--A--S--F
GCCCCCTTAACCTGGAGGTGGACCCCAATATCCAGGCT---GTGCGCACC---CAGGAGAAGGAGCAGATCAAGACCCTCAACAACAAGTTTGCCTCCTT
:::::::::: ::::::::::::::::::::::::::.   :::::::::     :::::::::::::::::::::.::::::::.::::::::::::::
GCCCCCTTAAGCTGGAGGTGGACCCCAATATCCAGGCCT--GTGCGCACCC--ATGGAGAAGGAGCAGATCAAGACTCTCAACAATAAGTTTGCCTCCTT
S--P--L--K--L--E--V--D--P--N--I--Q--A--\--V--R--T--\--Q--E--K--E--Q--I--K--T--L--N--N--K--F--A--S--F

----------------------------------------------------------------------------------------------------
--T--D--K--I--R--F--L--E--Q--Q--N--K--M--L--E--T--K--W--S--L--L--Q--Q--Q--K--M--A--Q--S--N--M--D--N-
CACAGACAAGATACGGTTCCTAGAGCAGCAGAACAAGATGCTGGAGACCAAGTGGAGCCTCCTGCAGCAGCAGAAGATGGCTCAGAGCAACATGGACAAC
::. ::::::.:.:::. :::.:::::::::::::::.: :::::::::::.::::.::::::::::::::::::::..::.:.::::::::: ::::::
CATCGACAAGGTGCGGCACCTGGAGCAGCAGAACAAGGTTCTGGAGACCAAATGGAACCTCCTGCAGCAGCAGAAGACAGCCCGGAGCAACATCGACAAC
--I--D--K--V--R--H--L--E--Q--Q--N--K--V--L--E--T--K--W--N--L--L--Q--Q--Q--K--T--A--R--S--N--I--D--N-

----------------------------------------------------------------------------------------------------
-M--F--G--S--Y--I--N--N--L--T--Q--Q--L--E--T--L--G--Q--E--K--L--K--L--E--V--E--L--G--N--M--Q--G--L--
ATGTTCGGGAGCTACATCAACAACCTTACGCAGCAGCTGGAGACTCTGGGCCAGGAGAAGCTGAAGCTGGAGGTGGAGCTTGGCAACATGCAGGGGCTGG
:::::::.::::::.:::::::::::.  ::.:::::::::.::.:::: ::::::::::::::::::::: ::::: ::::::: ::::::::: ::::
ATGTTCGAGAGCTATATCAACAACCTCCGGCGGCAGCTGGAAACCCTGGCCCAGGAGAAGCTGAAGCTGGACGTGGACCTTGGCACCATGCAGGGCCTGG
-M--F--E--S--Y--I--N--N--L--R--R--Q--L--E--T--L--A--Q--E--K--L--K--L--D--V--D--L--G--T--M--Q--G--L--

----------------------------------------------------------------------------------------------------
V--E--D--F--K--N--K--Y--E--D--E--I--H--K--L--T--E--M--E--N--E--F--V--L--I--K--K--E--V--D--E--A--Y--M
TGGAGGACTTCAAGAACAAGTATGAGGATGAGATCCATAAGCTTACAGAGATGGAGAATGAATTTGTCCTCATCAAGAAGGAGGTGGACGAAGCTTACAT
:::::::::::: ::::::::::::::: :::::::: :::: ::: :: :::                                               
TGGAGGACTTCACGAACAAGTATGAGGAGGAGATCCAAAAGCGTACCGACATG-----------------------------------------------
V--E--D--F--T--N--K--Y--E--E--E--I--Q--K--R--T--D--M------------------------------------------------

----------------------------------------------------------------------------------------------------
--N--K--V--E--L--G--S--R--L--E--G--L--T--D--E--I--N--F--L--R--Q--L--Y--E--E--E--I--R--E--L--Q--C--Q-
GAACAAGGTAGAGCTGGGGTCTCGCCTGGAAGGACTGACTGATGAGATCAACTTCCTCAGGCAGCTGTATGAAGAGGAGATCCGGGAGCTGCAGTGCCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------><------------------------------------------------------------
-I--S--D--T--S--A--V--L--S--M--D--N--S--S--L--D--M--D--S--I--I--A--E--V--K--V--Q--Y--E--E--I--T--N--
ATCTCAGACACATCTGCGGTGCTGTCCATGGACAACAGCTCCCTGGACATGGACAGCATCATCGCTGAGGTCAAGGTGCAGTACGAGGAGATCACCAACC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
H--S--Q--A--E--A--E--S--M--Y--Q--I--K--Y--E--E--L--Q--T--L--V--G--K--H--G--N--D--L--R--R--T--K--T--E
ACAGCCAGGCTGAGGCTGAGAGCATGTACCAGATCAAGTATGAGGAACTGCAGACGCTGGTTGGGAAGCACGGGAATGACCTGCGGCGCACAAAGACTGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--I--S--E--M--N--R--N--I--S--R--L--Q--A--E--A--E--G--L--K--G--Q--R--T--S--L--E--A--A--I--A--D--A--Q-
GATCTCCGAGATGAACCGGAACATCAGCCGACTCCAGGCTGAGGCTGAGGGTCTCAAGGGCCAGAGGACTTCCCTGGAGGCCGCCATAGCAGATGCCCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-Q--R--G--E--L--A--V--K--D--A--N--A--E--L--S--E--L--E--A--A--Q--E--R--A--K--Q--D--M--A--R--P--L--R--
CAGCGTGGGGAGCTGGCCGTTAAGGATGCCAACGCCGAGCTGTCGGAGCTGGAGGCCGCCCAGGAGCGGGCCAAGCAGGACATGGCGCGGCCGCTGCGTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
E--Y--Q--E--L--M--N--V--K--L--A--L--D--I--Q--I--A--T--Y--R--K--L--L--E--G--D--E--S--R--L--E--S--G--M
AGTACCAGGAGCTGATGAACGTGAAGCTGGCCCTGGACATCCAGATCGCCACCTACAGGAAGCTGCTGGAGGGCGACGAGAGCCGGCTGGAGTCTGGGAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------><----------------------------------------------------
--L--N--M--S--I--H--T--K--T--T--S--S--Y--A--G--A--F--G--G--L--T--S--P--G--L--S--Y--S--L--G--S--S--F-
GCTGAACATGAGCATCCATACGAAGACCACCAGCAGCTATGCAGGTGCCTTTGGGGGCCTCACAAGCCCCGGCCTCAGCTACAGCCTGGGCTCCAGCTTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--S--G--A--G--S--S--S--F--S--S--T--G--S--T--R--A--V--V--V--K--K--I--K--T--R--D--G--K--L--E--S--S--
GGCTCTGGGGCGGGCTCCAGCTCCTTCAGCAGCACCGGCTCCACCAGGGCTGTGGTTGTGAAGAAGATCAAGACCCGCGATGGGAAGCTGGAGTCCTCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------->
D--V--L--P--K--*-
ATGTCCTGCCCAAGTGA
                 
-----------------
-----------------

Pig Consensus Sequence

>BGISUST0000896420
---------------------------------GGTTACGGTGGGCCCTCAGGCTTgtGAGGCATCACAGCTGTCACAGTGAACCAGAGCCTGCTGAGCC
CCCTTAAGCTGGAGGTGGACCCCAATATCCAGGCcgTGCGCACcaTGGAGAAGGAGCAGATCAAGACTCTCAACAATAAGTTTGCCTCCTTCATCGACAA
GGTGCGGCACCTGGAGCAGCAGAACAAGGTTCTGGAGACCAAATGGAACCTCCTGCAGCAGCAGAAGACAGCCCGGAGCAACATCGACAACATGTTCGAG
AGCTATATCAACAACCTCCGGCGGCAGCTGGAAACCCTGGCCCAGGAGAAGCTGAAGCTGGACGTGGACCTTGGCACCATGCAGGGCCTGGTGGAGGACT
TCACGAACAAGTATGAGGAGGAGATCCAAAAGCGTACCGACATG--------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------


>BGISUSP0000896420
-----------GYGGPSGL*GITAVTVNQSLLSPLKLEVDPNIQAVRTMEKEQIKTLNNKFASFIDKVRHLEQQNKVLETKWNLLQQQKTARSNIDNMFE
SYINNLRRQLETLAQEKLKLDVDLGTMQGLVEDFTNKYEEEIQKRTDM----------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------