Sequences
EST Library Info
pigca2Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000185215 (click for geneview)
Transcript ID ENST00000333007(link to ensembl)
Symbol TNFAIP2
Localtion Chromosome:14:102662417:102673529:1 band: 14q32.32
Description Tumor necrosis factor, alpha-induced protein 2 (Primary response gene B94 protein). [Source:Uniprot/SWISSPROT;Acc:Q03169]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--E--A--S--S--E--D--L--V--P--P--L--E--A--G--A--A--P--Y--R--E--E--E--E--A--A--K--K--K--K--E--K--
ATGTCGGAGGCCTCCTCTGAGGACCTGGTGCCACCCCTGGAGGCTGGGGCAGCCCCATATAGGGAGGAGGAAGAGGCGGCGAAGAAGAAGAAGGAGAAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
K--K--K--S--K--G--L--A--N--V--F--C--V--F--T--K--G--K--K--K--K--G--Q--P--S--S--A--E--P--E--D--A--A--G
AGAAGAAGTCCAAAGGCCTGGCCAATGTGTTCTGCGTCTTCACCAAAGGGAAGAAGAAGAAGGGTCAGCCCAGCTCAGCGGAGCCCGAGGACGCAGCCGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------><----------------------------------------------------------------
--S--R--Q--G--L--D--G--P--P--P--T--V--E--E--L--K--A--A--L--E--R--G--Q--L--E--A--A--R--P--L--L--A--L-
GTCCAGGCAGGGGCTGGATGGCCCGCCCCCCACAGTGGAGGAGCTGAAGGCGGCGCTGGAGCGCGGGCAGCTGGAGGCGGCGCGGCCGCTGCTGGCGCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-E--R--E--L--A--A--A--A--A--A--G--G--V--S--E--E--E--L--V--R--R--Q--S--K--V--E--A--L--Y--E--L--L--R--
GAGCGGGAGCTGGCGGCGGCGGCGGCGGCGGGCGGTGTGAGCGAGGAGGAGCTGGTGCGGCGCCAGAGCAAGGTGGAGGCGCTGTACGAGCTGCTGCGCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
D--Q--V--L--G--V--L--R--R--P--L--E--A--P--P--E--R--L--R--Q--A--L--A--V--V--A--E--Q--E--R--E--D--R--Q
ACCAGGTGCTGGGCGTGCTGCGGCGGCCGCTGGAGGCGCCGCCCGAGCGGCTGCGCCAGGCGCTGGCCGTGGTGGCGGAGCAGGAGCGCGAGGACCGCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--A--A--A--A--G--P--G--T--S--G--L--A--A--T--R--P--R--R--W--L--Q--L--W--R--R--G--V--A--E--A--A--E--E-
GGCGGCGGCGGCGGGGCCGGGGACCTCGGGGCTGGCGGCCACGCGCCCGCGGCGCTGGCTGCAGCTGTGGCGGCGCGGCGTGGCGGAGGCGGCCGAGGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-R--M--G--Q--R--P--A--A--G--A--E--V--P--E--S--V--F--L--H--L--G--R--T--M--K--E--D--L--E--A--V--V--E--
CGCATGGGCCAGCGGCCGGCCGCGGGCGCCGAGGTCCCCGAGAGCGTCTTTCTGCACTTGGGCCGCACCATGAAGGAGGACCTGGAGGCCGTGGTGGAGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
R--L--K--P--L--F--P--A--E--F--G--V--V--A--A--Y--A--E--S--Y--H--Q--H--F--A--A--H--L--A--A--V--A--Q--F
GGCTGAAGCCGCTGTTCCCCGCCGAGTTCGGCGTCGTGGCGGCCTACGCCGAGAGCTACCACCAGCACTTCGCGGCCCACCTGGCCGCCGTGGCGCAGTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------------------><---------------------------------------
--E--L--C--E--R--D--T--Y--M--L--L--L--W--V--Q--N--L--Y--P--N--D--I--I--N--S--P--K--L--V--G--E--L--Q-
CGAGCTGTGCGAGCGCGACACCTACATGCTGCTGCTCTGGGTGCAGAACCTCTACCCCAATGACATCATCAACAGCCCCAAGCTGGTGGGTGAGCTGCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------><------------------------
-G--M--G--L--G--S--L--L--P--P--R--Q--I--R--L--L--E--A--T--F--L--S--S--E--A--A--N--V--R--E--L--M--D--
GGTATGGGGCTCGGGAGCCTCCTGCCCCCCAGGCAGATCCGACTGCTGGAGGCCACATTCCTGTCCAGTGAGGCGGCCAATGTGAGGGAGTTGATGGACC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------------------------------------------><-
R--A--L--E--L--E--A--R--R--W--A--E--D--V--P--P--Q--R--L--D--G--H--C--H--S--E--L--A--I--D--I--I--Q--I
GAGCTCTGGAGCTAGAGGCACGGCGCTGGGCTGAGGATGTGCCTCCCCAGAGGCTGGACGGCCACTGCCACAGCGAGCTGGCCATCGACATCATCCAGAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------------------><
--T--S--Q--A--Q--A--K--A--E--S--I--T--L--D--L--G--S--Q--I--K--R--V--L--L--V--E--L--P--A--F--L--R--S-
CACCTCCCAGGCCCAGGCCAAGGCCGAGAGCATCACGCTGGACTTGGGCTCACAGATAAAGCGGGTGCTGCTGGTGGAGCTGCCTGCGTTCCTGAGGAGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------------------------------------------><-
-Y--Q--R--A--F--N--E--F--L--E--R--G--K--Q--L--T--N--Y--R--A--N--V--I--A--N--I--N--N--C--L--S--F--R--
TACCAGCGCGCCTTTAATGAATTTCTGGAGAGAGGCAAGCAGCTGACGAATTACAGGGCCAATGTTATTGCCAACATCAACAACTGCCTGTCCTTCCGGA
               .:::: ::::::::::: .::::.:: :::. .:::::::::::::::::.::.:::::::::::::::::::::::::::    
---------------GATGATTTTCTGGAGAGCAGCAAACATCTGGGAAATTACAGGGCCAATGTCATCGCCAACATCAACAACTGCCTGTCCTTC----
----------------D--D--F--L--E--S--S--K--H--L--G--N--Y--R--A--N--V--I--A--N--I--N--N--C--L--S--F-----

----------------------------------------------------------------------------------------------------
M--S--M--E--Q--N--W--Q--V--P--Q--D--T--L--S--L--L--L--G--P--L--G--E--L--K--S--H--G--F--D--T--L--L--Q
TGTCCATGGAGCAGAATTGGCAGGTACCCCAGGACACCCTGAGCCTCCTGCTGGGCCCCCTGGGTGAGCTCAAGAGCCACGGCTTTGACACCCTGCTCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------><-----------------------------------------------------------------------------
--N--L--H--E--D--L--K--P--L--F--K--R--F--T--H--T--R--W--A--A--P--V--E--T--L--E--N--I--I--A--T--V--D-
GAACCTGCATGAGGACCTGAAGCCACTGTTCAAGAGGTTCACGCACACCCGCTGGGCGGCCCCTGTGGAGACCCTGGAAAACATCATCGCCACTGTAGAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------><------------------------------------------------------
-T--R--L--P--E--F--S--E--L--Q--G--C--F--R--E--E--L--M--E--A--L--H--L--H--L--V--K--E--Y--I--I--Q--L--
ACGAGGCTGCCTGAGTTCTCAGAGCTGCAGGGCTGTTTCCGGGAGGAGCTCATGGAGGCCTTGCACCTGCACCTGGTGAAGGAGTACATCATCCAACTCA
                                             :::::::::::::.: :.:::::::::::::::::::::::::::::::. ::::
---------------------------------------------GAGCTCATGGAGGTCATACACCTGCACCTGGTGAAGGAGTACATCATCCGCCTCA
----------------------------------------------E--L--M--E--V--I--H--L--H--L--V--K--E--Y--I--I--R--L--

----------------------------------------------------------------------------------------------------
S--K--G--R--L--V--L--K--T--A--E--Q--Q--Q--Q--L--A--G--Y--I--L--A--N--A--D--T--I--Q--H--F--C--T--Q--H
GCAAGGGGCGCCTGGTCCTCAAGACGGCCGAGCAGCAGCAGCAGCTGGCTGGGTACATCCTGGCCAATGCTGACACCATCCAGCACTTCTGCACCCAGCA
::::: :::::::::::::::.:::: : :::::::::::::::::::: :::.:::::::::: ::.:: ::  .::::::: ::::::::        
GCAAGCGGCGCCTGGTCCTCAGGACGCCGGAGCAGCAGCAGCAGCTGGCGGGGCACATCCTGGCGAACGCGGAGCTCATCCAGAACTTCTGC--------
S--K--R--R--L--V--L--R--T--P--E--Q--Q--Q--Q--L--A--G--H--I--L--A--N--A--E--L--I--Q--N--F--C---------

><--------------------------------------------------------------------------------------------------
--G--S--P--A--T--W--L--Q--P--A--L--P--T--L--A--E--I--I--R--L--Q--D--P--S--A--I--K--I--E--V--A--T--Y-
CGGCTCCCCGGCGACCTGGCTGCAGCCTGCTCTCCCTACGCTGGCCGAGATCATTCGCCTGCAGGACCCCAGTGCCATCAAGATTGAGGTGGCCACTTAT
 :::::::: ::.::::::::::: : :::.:::::.::.:: :::::::::::::::::::::::::::::::::::::::::.:::::.:::::::::
-GGCTCCCCCGCAACCTGGCTGCATCGTGCCCTCCCCACACTCGCCGAGATCATTCGCCTGCAGGACCCCAGTGCCATCAAGATCGAGGTAGCCACTTAT
--G--S--P--A--T--W--L--H--R--A--L--P--T--L--A--E--I--I--R--L--Q--D--P--S--A--I--K--I--E--V--A--T--Y-

----------------------><----------------------------------------------------------------------------
-A--T--C--Y--P--D--F--S--K--G--H--L--S--A--I--L--A--I--K--G--N--L--S--N--S--E--V--K--R--I--R--S--I--
GCCACCTGCTACCCTGACTTCAGCAAAGGCCACCTGAGCGCTATCCTGGCCATCAAGGGGAACCTATCCAACAGTGAGGTCAAGCGCATCCGGAGCATCT
:::::::: ::::::::::::   :::::::::::::::::.:::.:::::::::::::::::::.::::.::::::::::::: :::::::.:::::..
GCCACCTGGTACCCTGACTTC---AAAGGCCACCTGAGCGCCATCTTGGCCATCAAGGGGAACCTGTCCAGCAGTGAGGTCAAGAGCATCCGAAGCATTC
-A--T--W--Y--P--D--F-----K--G--H--L--S--A--I--L--A--I--K--G--N--L--S--S--S--E--V--K--S--I--R--S--I--

---------------------------------------------------------------->
L--D--V--S--M--G--A--Q--E--P--S--R--P--L--F--S--L--I--K--V--G--*-
TGGACGTCAGCATGGGGGCGCAGGAGCCCTCCCGGCCCCTATTTTCCCTTATAAAGGTTGGTTAG
:::::.:::.::.::::::::: ::::::::: .:::::::::::: :::::: : :::::::::
TGGACATCAACACGGGGGCGCACGAGCCCTCCAAGCCCCTATTTTCACTTATACATGTTGGTTAG
L--D--I--N--T--G--A--H--E--P--S--K--P--L--F--S--L--I--H--V--G--*-

Pig Consensus Sequence

>BGISUST0000902274
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------GATGATTTTCTGGAGAGCAGCAAACATCTGGGAAATTACAGGGCCAATGTCATCGCCAACATCAACAACTGCCTGTCCTTC----
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------GAGCTCATGGAGGTCATACACCTGCACCTGGTGAAGGAGTACATCATCCGCCTCA
GCAAGCGGCGCCTGGTCCTCAGGACGCCGGAGCAGCAGCAGCAGCTGGCGGGGCACATCCTGGCGAACGCGGAGCTCATCCAGAACTTCTGC--------
-GGCTCCCCCGCAACCTGGCTGCATCGTGCCCTCCCCACACTCGCCGAGATCATTCGCCTGCAGGACCCCAGTGCCATCAAGATCGAGGTAGCCACTTAT
GCCACCTGGTACCCTGACTTC---AAAGGCCACCTGAGCGCCATCTTGGCCATCAAGGGGAACCTGTCCAGCAGTGAGGTCAAGAGCATCCGAAGCATTC
TGGACATCAACACGGGGGCGCACGAGCCCTCCAAGCCCCTATTTTCACTTATACATGTTGGTTAG


>BGISUSP0000902274
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----DDFLESSKHLGNYRANVIANINNCLSF--------------------------------------------------------------------
---------------ELMEVIHLHLVKEYIIRLSKRRLVLRTPEQQQQLAGHILANAELIQNFC---GSPATWLHRALPTLAEIIRLQDPSAIKIEVATY
ATWYPDF-KGHLSAILAIKGNLSSSEVKSIRSILDINTGAHEPSKPLFSLIHVG*