Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000184542 (click for geneview)
Transcript ID ENST00000333751(link to ensembl)
Symbol KCTD11
Localtion Chromosome:17:7196205:7198984:1 band: 17p13.1
Description potassium channel tetramerisation domain containing 11
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-G--F--L--C--P--D--T--T--S--P--S--T--T--K--V--A--G--V--S--P--K--P--Y--W--V--C--S--T-----C--A--S--N--
GGATTTCTGTGTCCTGACACCACCTCCCCATCCACCACCAAAGTAGCCGGGGTGAGCCCCAAACCTTACTGGGTGTGCTCCACC---TGTGCCTCCAACC
                           :: ::: :::::: ::::::.::.:::::::::: :.:::.:::  . ::. :. :    :::::::::.:::
---------------------------CCCTCCCCCACCACAGTAGCTGGAGTGAGCCCCACATCTTGCTG-CCTTGTACTCCAATTTGTGCCTCCGACC
----------------------------P--S--P--T--T--V--A--G--V--S--P--T--S--C--W--P--C--T--P--I--C--A--S--D--

----------------------------------------------------------------------------------------------------
P--A--N-----L--T--A--S--T--Q--F--C--T--H--P--G--S--S--A--F--S--F--L--S--V--S--P--V--L--P--K--I--S--P
CAGCGAAT---CTGACAGCTTCGACCCAATTCTGCACACACCCAGGAAGTTCTGCCTTTTCTTTTCTTTCGGTGTCTCCTGTACTTCCCAAAATTTCTCC
:::  .:.   ::::   .: :: ::::.:::::::::::::::::::::::.::::::::::.::::::::::::.:: :::::.:.:::::::::.::
CAGA-GACTGCCTGAACTTTACGCCCCAGTTCTGCACACACCCAGGAAGTTCCGCCTTTTCTTCTCTTTCGGTGTCCCCAGTACTCCTCAAAATTTCCCC
P--A--D--C--L--N--F--T--P--Q--F--C--T--H--P--G--S--S--A--F--S--S--L--S--V--S--P--V--L--L--K--I--S--P

----------------------------------------------------------------------------------------------------
--P--P--V--P--S--S--P--P--S--F--G--G--P--V--T--L--N--V--G--G--T--L--Y--S--T--T--L--E--T--L--T--R--F-
TCCTCCTGTGCCCTCTTCGCCCCCCTCCTTTGGGGGCCCCGTGACCCTGAATGTGGGGGGCACACTATATTCCACCACTTTGGAGACCCTGACCCGCTTC
::::::::::::::::.:::::::: :::::::::::::.:::::::::::::::::::::::.::::::::::::::::::::::: :::::.:: :::
TCCTCCTGTGCCCTCTCCGCCCCCCGCCTTTGGGGGCCCTGTGACCCTGAATGTGGGGGGCACGCTATATTCCACCACTTTGGAGACGCTGACTCGATTC
--P--P--V--P--S--P--P--P--A--F--G--G--P--V--T--L--N--V--G--G--T--L--Y--S--T--T--L--E--T--L--T--R--F-

----------------------------------------------------------------------------------------------------
-P--D--S--M--L--G--A--M--F--R--A--G--T--P--M--P--P--N--L--N--S--Q--G--G--G--H--Y--F--I--D--R--D--G--
CCAGACTCTATGCTGGGGGCCATGTTTAGGGCCGGCACCCCCATGCCCCCCAACCTCAATTCCCAAGGAGGCGGCCACTACTTCATCGACCGGGATGGCA
::::::::.::::::::::::::::::::::::::.::::::::: ::::::::::::.:.::::.:::::.::::::::::::::::::::.:::::::
CCAGACTCCATGCTGGGGGCCATGTTTAGGGCCGGTACCCCCATGACCCCCAACCTCAGTCCCCAGGGAGGTGGCCACTACTTCATCGACCGAGATGGCA
-P--D--S--M--L--G--A--M--F--R--A--G--T--P--M--T--P--N--L--S--P--Q--G--G--G--H--Y--F--I--D--R--D--G--

----------------------------------------------------------------------------------------------------
K--A--F--R--H--I--L--N--F--L--R--L--G--R--L--D--L--P--R--G--Y--G--E--T--A--L--L--R--A--E--A--D--F--Y
AGGCCTTCCGGCACATCCTCAATTTCCTGAGGCTGGGCCGCCTGGACCTGCCCCGTGGGTACGGAGAGACAGCGCTGCTCAGGGCAGAGGCTGACTTCTA
::::::::::::::::::::::.::.::: :::::::::::::::::.::::::::::.::.::.:::::.::::: ::: ::::::::::::::::.::
AGGCCTTCCGGCACATCCTCAACTTTCTGCGGCTGGGCCGCCTGGACTTGCCCCGTGGATATGGGGAGACGGCGCTTCTCCGGGCAGAGGCTGACTTTTA
K--A--F--R--H--I--L--N--F--L--R--L--G--R--L--D--L--P--R--G--Y--G--E--T--A--L--L--R--A--E--A--D--F--Y

----------------------------------------------------------------------------------------------------
--Q--I--R--P--L--L--D--A--L--R--E--L--E--A--S--Q--G--T--P--A--P--T--A--A--L--L--H--A--D--V--D--V--S-
CCAGATCCGGCCCCTCCTGGACGCGCTGCGGGAACTGGAGGCCTCTCAGGGGACCCCTGCACCCACAGCTGCCCTGCTCCACGCAGATGTAGATGTCAGC
::::::::::::.::::::::.:: .::::::::::.::::: ::::.::::::::: ::::: :::::.::::::::::::::::::::::: . ::::
CCAGATCCGGCCTCTCCTGGATGCCTTGCGGGAACTAGAGGCATCTCGGGGGACCCCGGCACC-ACAGCCGCCCTGCTCCACGCAGATGTAGAAAGCAGC
--Q--I--R--P--L--L--D--A--L--R--E--L--E--A--S--R--G--T--P--A--P--T--A--A--L--L--H--A--D--V--E--S--S-

----------------------------------------------------------------------------------------------------
-P--R--L--V--H--F--S--A--R--R--G--P--H--H--Y--E--L--S--S--V--Q--V--D--T--F--R--A--N--L--F--C--T--D--
CCCCGCCTGGTGCACTTCTCTGCTCGCCGGGGACCCCATCACTATGAGCTGAGCTCCGTCCAGGTGGACACCTTCCGAGCCAACCTTTTCTGCACCGACT
::::::::::::::::::::.::::::::::: :: ::.:::::::::::::::::.::::::::::::::::::::.::::::::.::::::::::::.
CCCCGCCTGGTGCACTTCTCCGCTCGCCGGGGCCCGCACCACTATGAGCTGAGCTCTGTCCAGGTGGACACCTTCCGGGCCAACCTCTTCTGCACCGACC
-P--R--L--V--H--F--S--A--R--R--G--P--H--H--Y--E--L--S--S--V--Q--V--D--T--F--R--A--N--L--F--C--T--D--

----------------------------------------------------------------------------------------------------
S--E--C--L--G--A--L--R--A--R--F--G--V--A--S--G--D--R--A--E--G--S--P--H--F--H--L--E--W--A--P--R--P--V
CTGAGTGTCTAGGTGCTTTGCGGGCCCGATTTGGTGTGGCCAGTGGGGATAGGGCAGAGGGGAGCCCACATTTTCATCTGGAGTGGGCCCCCCGCCCCGT
:.::::::::.:::::. ::::::::::::::::::::::::.::. ::.:::::.:::::..:::::::.::::.:::::::::::::::::::::: .
CCGAGTGTCTGGGTGCCATGCGGGCCCGATTTGGTGTGGCCAATGACGACAGGGCGGAGGGAGGCCCACACTTTCGTCTGGAGTGGGCCCCCCGCCCCTC
P--E--C--L--G--A--M--R--A--R--F--G--V--A--N--D--D--R--A--E--G--G--P--H--F--R--L--E--W--A--P--R--P--S

----------------------------------------------------------------------------------------------------
--E--L--P--E--V--E--Y--G--R--L--G--L--Q--P--L--W--T--G--G--P--G--E--R--R--E--V--V--G--T--P--S--F--L-
GGAACTCCCCGAGGTGGAGTATGGGAGACTGGGGCTGCAGCCGCTGTGGACTGGGGGGCCAGGAGAGCGGCGGGAGGTGGTGGGCACCCCAAGCTTCCTG
:::::::                                                                                             
GGAACTC---------------------------------------------------------------------------------------------
--E--L----------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-E--E--V--L--R--V--A--L--E--H--G--F--R--L--D--S--V--F--P--D--P--E--D--L--L--N--S--R--S--L--R--F--V--
GAGGAGGTGCTGCGGGTGGCTCTCGAGCACGGCTTCCGACTAGACTCTGTCTTCCCCGACCCCGAAGACCTGCTCAACTCCAGGTCTCTGCGCTTTGTCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------
R--H--*-
GGCACTGA
        
--------
--------

Pig Consensus Sequence

>BGISUST0000882373
---------------------------CCCTCCCCCACCACAGTAGCTGGAGTGAGCCCCACATCTTGccCTTGTACTCCAATTTGTGCCTCCGAcaGAG
ACTGCCTGAACTTTACGCCCCAGTTCTGCACACACCCAGGAAGTTCCGCCTTTTCTTCTCTTTCGGTGTCCCCAGTACTCCTCAAAATTTCCCCTCCTCC
TGTGCCCTCTCCGCCCCCCGCCTTTGGGGGCCCTGTGACCCTGAATGTGGGGGGCACGCTATATTCCACCACTTTGGAGACGCTGACTCGATTCCCAGAC
TCCATGCTGGGGGCCATGTTTAGGGCCGGTACCCCCATGACCCCCAACCTCAGTCCCCAGGGAGGTGGCCACTACTTCATCGACCGAGATGGCAAGGCCT
TCCGGCACATCCTCAACTTTCTGCGGCTGGGCCGCCTGGACTTGCCCCGTGGATATGGGGAGACGGCGCTTCTCCGGGCAGAGGCTGACTTTTACCAGAT
CCGGCCTCTCCTGGATGCCTTGCGGGAACTAGAGGCATCTCGGGGGACcgGCACCACAGCCGCCCTGCTCCACGCAGATGTAGAAAGCAGCCCCCGCCTG
GTGCACTTCTCCGCTCGCCGGGGCCCGCACCACTATGAGCTGAGCTCTGTCCAGGTGGACACCTTCCGGGCCAACCTCTTCTGCACCGACCCCGAGTGTC
TGGGTGCCATGCGGGCCCGATTTGGTGTGGCCAATGACGACAGGGCGGAGGGAGGCCCACACTTTCGTCTGGAGTGGGCCCCCCGCCCCTCG--------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------------------------------------------


>BGISUSP0000882373
---------PSPTTVAGVSPTSCPCTPICASDRDCLNFTPQFCTHPGSSAFSSLSVSPVLLKISPPPVPSPPPAFGGPVTLNVGGTLYSTTLETLTRFPD
SMLGAMFRAGTPMTPNLSPQGGGHYFIDRDGKAFRHILNFLRLGRLDLPRGYGETALLRAEADFYQIRPLLDALRELEASRGTGTTAALLHADVESSPRL
VHFSARRGPHHYELSSVQVDTFRANLFCTDPECLGAMRARFGVANDDRAEGGPHFRLEWAPRPS------------------------------------
-------------------------------