Sequences
EST Library Info
ebs1Foetus 50 days, brain stem
eje1Foetus 50 days, jejunum
hlv1Heart, left ventricle
nbm1Newborn 115 days, bone marrow (pelvis)
sme1M. Semimembranosus
Clusters
Oligos
SNPs

Gene ID ENSG00000183011 (click for geneview)
Transcript ID ENST00000333775(link to ensembl)
Symbol NP_115732.2
Localtion Chromosome:17:7700730:7701466:-1 band: 17p13.1
Description hypothetical protein MGC14151
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--V--A--V--G--V--R--A--A--P--V--L--G--L--A--R--A--L--V--L--G--L--R--G--S--Q--A--A--R--W--R--G--
ATGGCTGTTGCAGTCGGCGTCAGAGCAGCTCCAGTGCTGGGGTTAGCACGGGCTCTGGTTCTGGGACTGAGGGGCAGTCAAGCAGCAAGATGGAGGGGGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
W--G--T--A--A--P--G--S--L--W--A--L--C--E--C--P--A--G--C--R--E--L--W--F--R--G--R--A--A--W--A--A--R--S
GGGGAACTGCAGCTCCCGGCAGCCTCTGGGCTTTGTGTGAGTGCCCCGCGGGCTGCCGGGAGCTGTGGTTCCGCGGGCGGGCAGCCTGGGCTGCGCGGTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--E--R--L--L--H--P--A--Q--D--S--D--G--E--R--E--D--S--A--A--E--R--A--R--Q--Q--L--E--A--L--L--N--K--T-
TGAGCGCTTGTTACACCCCGCGCAGGATTCGGACGGAGAGCGCGAGGACTCGGCGGCTGAGCGCGCCCGACAGCAGCTAGAGGCGCTGCTCAACAAGACT
                   ::  .:::.::.:::::.::::::::.:::::: :: ::: ::::::. :.::::::::.:::::::::::::::::::::
-------------------GCCGGGGACTCAGACGGGGAGCGCGAAGACTCGCCGTCTGCGCGCGCTAGGCAGCAGCTGGAGGCGCTGCTCAACAAGACT
--------------------A--G--D--S--D--G--E--R--E--D--S--P--S--A--R--A--R--Q--Q--L--E--A--L--L--N--K--T-

----------------------------------------------------------------------------------------------------
-M--R--I--R--M--T--D--G--R--T--L--V--G--C--F--L--C--T--D--R--D--C--N--V--I--L--G--S--A--Q--E--F--L--
ATGCGCATTCGCATGACAGATGGACGGACACTGGTCGGCTGCTTCCTCTGCACTGACCGTGACTGCAATGTCATCCTGGGCTCGGCGCAGGAGTTCCTCA
::::: ::::::::::::::::::::::::::::::::.::::::::::::::.:::::.:::::::::::.:::::.::::::::::::::::::::::
ATGCGGATTCGCATGACAGATGGACGGACACTGGTCGGTTGCTTCCTCTGCACCGACCGCGACTGCAATGTTATCCTAGGCTCGGCGCAGGAGTTCCTCA
-M--R--I--R--M--T--D--G--R--T--L--V--G--C--F--L--C--T--D--R--D--C--N--V--I--L--G--S--A--Q--E--F--L--

--------><------------------------------------------------------------------------------------------
K--P--S--D--S--F--S--A--G--E--P--R--V--L--G--L--A--M--V--P--G--H--H--I--V--S--I--E--V--Q--R--E--S--L
AGCCGTCGGATTCCTTCTCTGCCGGGGAGCCCCGTGTGCTGGGCCTGGCCATGGTACCCGGACACCACATCGTTTCCATTGAGGTGCAGAGGGAGAGTCT
::::::::   :::::::::::::::::.:::::::::::::::::.::.::::::::.:::::::::::::::::.:::::::::::.::.:::::.::
AGCCGTCG---TCCTTCTCTGCCGGGGAACCCCGTGTGCTGGGCCTAGCTATGGTACCTGGACACCACATCGTTTCTATTGAGGTGCAAAGAGAGAGCCT
K--P--S-----S--F--S--A--G--E--P--R--V--L--G--L--A--M--V--P--G--H--H--I--V--S--I--E--V--Q--R--E--S--L

--------------------->
--T--G--P--P--Y--L--*-
GACCGGGCCTCCGTATCTCTGA
:.: :::::::: :::::::::
GGCGGGGCCTCCCTATCTCTGA
--A--G--P--P--Y--L--*-

Pig Consensus Sequence

>BGISUST0000897621
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------GCCGGGGACTCAGACGGGGAGCGCGAAGACTCGCCGTCTGCGCGCGCTAGGCAGCAGCTGGAGGCGCTGCTCAACAAGACT
ATGCGGATTCGCATGACAGATGGACGGACACTGGTCGGTTGCTTCCTCTGCACCGACCGCGACTGCAATGTTATCCTAGGCTCGGCGCAGGAGTTCCTCA
AGCCGTCG---TCCTTCTCTGCCGGGGAACCCCGTGTGCTGGGCCTAGCTATGGTACCTGGACACCACATCGTTTCTATTGAGGTGCAAAGAGAGAGCCT
GGCGGGGCCTCCCTATCTCTGA


>BGISUSP0000897621
-------------------------------------------------------------------------AGDSDGEREDSPSARARQQLEALLNKT
MRIRMTDGRTLVGCFLCTDRDCNVILGSAQEFLKPS-SFSAGEPRVLGLAMVPGHHIVSIEVQRESLAGPPYL*