Sequences
EST Library Info
cad2Unavailable
cbl1Blood
cje1Jejunum - RNA from China
cly1Lymph - RNA from China
cmu1Rhinal mucous membrane - RNA from China
cut3Uterus - RNA from China
eep1Foetus 50 days, epidermis
fat1Fatt
jej1Small intestine, jejunum
med1Mediastinum
ova1Ovary
pldo2Unavailable
pliv1Unavailable
sme1M. Semimembranosus
spl2Spleen
tes4Testes
ton2Tip of tongue, mucosal membrane
tra1Trachea
ute1Uterus
vin1M. Vastus intermedius
Clusters
Oligos
SNPs

Gene ID ENSG00000095794 (click for geneview)
Transcript ID ENST00000333809(link to ensembl)
Symbol CREM
Localtion Chromosome:10:35477306:35540764:1 band: 10p11.21
Description cAMP responsive element modulator. [Source:Uniprot/SWISSPROT;Acc:Q03060]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--T--M--E--T--V--E--S--Q--H--D--G--S--I--T--A--S--L--T--E--S--K--S--A--H--V--Q--T--Q--T--G--Q--N--
ATGACCATGGAAACAGTTGAATCCCAGCATGATGGAAGTATAACAGCTTCTTTGACAGAGAGCAAGTCTGCTCATGTGCAGACTCAGACTGGCCAAAATT
:::::::::::::::.:::: ::.::::: :::::::::::: ::: :::: ::.::::::::.:.:::::::::.::::::. ::::::::.:::::::
ATGACCATGGAAACAATTGACTCTCAGCAGGATGGAAGTATACCAGATTCTGTGGCAGAGAGCGAATCTGCTCATATGCAGATGCAGACTGGTCAAAATT
-M--T--M--E--T--I--D--S--Q--Q--D--G--S--I--P--D--S--V--A--E--S--E--S--A--H--M--Q--M--Q--T--G--Q--N--

-------------------><-------------------------------------------------------------------------------
S--I--P--A--L--A--Q--V--S--V--A--G--S--G--T--R--R--G--S--P--A--V--T--L--V--Q--L--P--S--G--Q--T--I--H
CAATCCCTGCTTTAGCTCAGGTTTCTGTGGCTGGATCAGGCACCAGAAGAGGCTCCCCAGCTGTAACTCTAGTGCAGTTACCTTCGGGCCAAACTATACA
::.::::..:::::::::::::::::::.:::::::::::::::.::::::::::::::::::::::::::::::::::::::::.:::::::::.: ::
CAGTCCCCACTTTAGCTCAGGTTTCTGTAGCTGGATCAGGCACCGGAAGAGGCTCCCCAGCTGTAACTCTAGTGCAGTTACCTTCAGGCCAAACTGTCCA
S--V--P--T--L--A--Q--V--S--V--A--G--S--G--T--G--R--G--S--P--A--V--T--L--V--Q--L--P--S--G--Q--T--V--H

------------------------------------------------------------------><--------------------------------
--V--Q--G--V--I--Q--T--P--Q--P--W--V--I--Q--S--S--E--I--H--T--V--Q--V--A--A--I--A--E--T--D--E--S--A-
TGTCCAGGGAGTAATTCAGACACCACAGCCATGGGTTATTCAGTCATCAGAAATACACACCGTTCAGGTAGCAGCAATTGCAGAGACAGATGAATCTGCA
::::::::::::::::: :::::::::::::: :.:::::::::::.:: ::::::: ::.::::::::::::.:::::::::::::::::::.::::::
TGTCCAGGGAGTAATTCCGACACCACAGCCATCGATTATTCAGTCACCACAAATACAAACTGTTCAGGTAGCAACAATTGCAGAGACAGATGAGTCTGCA
--V--Q--G--V--I--P--T--P--Q--P--S--I--I--Q--S--P--Q--I--Q--T--V--Q--V--A--T--I--A--E--T--D--E--S--A-

----------------------------------------------------------------><----------------------------------
-E--S--E--G--V--I--D--S--H--K--R--R--E--I--L--S--R--R--P--S--Y--R--K--I--L--N--E--L--S--S--D--V--P--
GAATCAGAAGGTGTAATTGATTCTCATAAACGTAGAGAAATCCTTTCACGAAGACCCTCTTATAGGAAAATACTGAATGAACTGTCCTCTGATGTGCCTG
::::::::::::::::::::.::::::::::::::::::::::: :::::::::::.::::::   ::::::::::::::::: ::::::::::::::::
GAATCAGAAGGTGTAATTGACTCTCATAAACGTAGAGAAATCCTGTCACGAAGACCTTCTTAT---AAAATACTGAATGAACTTTCCTCTGATGTGCCTG
-E--S--E--G--V--I--D--S--H--K--R--R--E--I--L--S--R--R--P--S--Y-----K--I--L--N--E--L--S--S--D--V--P--

----------------------------------------------------------------------------------------------------
G--V--P--K--I--E--E--E--R--S--E--E--E--G--T--P--P--S--I--A--T--M--A--V--P--T--S--I--Y--Q--T--S--T--G
GTGTTCCCAAGATTGAAGAAGAGAGATCAGAGGAAGAAGGAACACCACCTAGTATTGCTACCATGGCAGTACCAACTAGCATATATCAGACTAGCACGGG
::::::::::::::::::::::.:.::::::::::::::::::.:::::::.:::.:::.::::::::::.::.::::::::::::::::::::::::::
GTGTTCCCAAGATTGAAGAAGAAAAATCAGAGGAAGAAGGAACGCCACCTAATATCGCTGCCATGGCAGTGCCGACTAGCATATATCAGACTAGCACGGG
G--V--P--K--I--E--E--E--K--S--E--E--E--G--T--P--P--N--I--A--A--M--A--V--P--T--S--I--Y--Q--T--S--T--G

-------><-------------------------------------------------------------------------------------------
--Q--Y--I--A--I--A--Q--G--G--T--I--Q--I--S--N--P--G--S--D--G--V--Q--G--L--Q--A--L--T--M--T--N--S--G-
GCAATACATTGCTATAGCCCAAGGTGGAACAATCCAGATTTCTAACCCAGGATCTGATGGTGTTCAGGGACTGCAGGCATTAACAATGACAAATTCAGGA
:::::::   ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GCAATAC---GCTATAGCCCAAGGTGGAACAATCCAGATTTCTAACCCAGGATCTGATGGTGTTCAGGGACTGCAGGCATTAACAATGACAAATTCAGGA
--Q--Y-----A--I--A--Q--G--G--T--I--Q--I--S--N--P--G--S--D--G--V--Q--G--L--Q--A--L--T--M--T--N--S--G-

------------------------------------------------------------------------------------------------><--
-A--P--P--P--G--A--T--I--V--Q--Y--A--A--Q--S--A--D--G--T--Q--Q--F--F--V--P--G--S--Q--V--V--V--Q--A--
GCTCCTCCACCAGGTGCTACAATTGTACAGTACGCAGCACAATCAGCTGATGGCACACAGCAGTTCTTTGTCCCAGGCAGCCAGGTTGTTGTTCAAGCTG
::::::::.::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::: :: ::::::   :
GCTCCTCCGCCAGGTGCTACAATTGTACAGTACGCAGCACAGTCAGCTGATGGCACACAGCAGTTCTTTGTCCCAGGCAGCCAGGTGGTGGTTCAA---G
-A--P--P--P--G--A--T--I--V--Q--Y--A--A--Q--S--A--D--G--T--Q--Q--F--F--V--P--G--S--Q--V--V--V--Q-----

----------------------------------------------------------------------------------------------------
A--T--G--D--M--P--T--Y--Q--I--R--A--P--T--A--A--L--P--Q--G--V--V--M--A--A--S--P--G--S--L--H--S--P--Q
CCACTGGTGACATGCCAACTTACCAGATCCGAGCTCCTACTGCTGCTTTGCCACAGGGAGTGGTGATGGCTGCATCGCCCGGAAGTTTGCACAGTCCCCA
::::::::::::::::.:::::.:::::::::::::: :::.:::::::::: :::::::::::::::::::: :: :: :::::..:::::::.:::::
CCACTGGTGACATGCCGACTTATCAGATCCGAGCTCCGACTACTGCTTTGCCTCAGGGAGTGGTGATGGCTGCCTCTCCGGGAAGCCTGCACAGCCCCCA
A--T--G--D--M--P--T--Y--Q--I--R--A--P--T--T--A--L--P--Q--G--V--V--M--A--A--S--P--G--S--L--H--S--P--Q

-----------------------------------------------------><---------------------------------------------
--Q--L--A--E--E--A--T--R--K--R--E--L--R--L--M--K--N--R--E--A--A--K--E--C--R--R--R--K--K--E--Y--V--K-
GCAGCTGGCAGAAGAAGCAACACGCAAACGAGAGCTGAGGCTAATGAAAAACAGGGAAGCTGCCAAAGAATGTCGACGTCGAAAGAAAGAATATGTAAAA
:::.::.:::::.::.::::::::::::::::::::::::::::::::::::   ::::::::.::.:::::::: ::::::::::::::.::::: ::.
GCAACTAGCAGAGGAGGCAACACGCAAACGAGAGCTGAGGCTAATGAAAAAC---GAAGCTGCTAAGGAATGTCGCCGTCGAAAGAAAGAGTATGTCAAG
--Q--L--A--E--E--A--T--R--K--R--E--L--R--L--M--K--N-----E--A--A--K--E--C--R--R--R--K--K--E--Y--V--K-

----------------------------------------------------------------------------------------------------
-C--L--E--S--R--V--A--V--L--E--V--Q--N--K--K--L--I--E--E--L--E--T--L--K--D--I--C--S--P--K--T--D--Y--
TGTCTGGAGAGCCGAGTTGCAGTGCTGGAAGTCCAGAACAAGAAGCTTATAGAGGAACTTGAAACCTTGAAAGACATTTGTTCTCCCAAAACAGATTACT
:::::::::::.::.:::::::::::::::::.::::::::::::::.::::::::::: ::::::.:::::::::::::.:::::.::::::::::: :
TGTCTGGAGAGTCGGGTTGCAGTGCTGGAAGTTCAGAACAAGAAGCTCATAGAGGAACTGGAAACCCTGAAAGACATTTGCTCTCCTAAAACAGATTAGT
-C--L--E--S--R--V--A--V--L--E--V--Q--N--K--K--L--I--E--E--L--E--T--L--K--D--I--C--S--P--K--T--D--*--

->
*-
AG
::
AG
*-

Pig Consensus Sequence

>BGISUST0000890148
ATGACCATGGAAACAATTGACTCTCAGCAGGATGGAAGTATACCAGATTCTGTGGCAGAGAGCGAATCTGCTCATATGCAGATGCAGACTGGTCAAAATT
CAGTCCCCACTTTAGCTCAGGTTTCTGTAGCTGGATCAGGCACCGGAAGAGGCTCCCCAGCTGTAACTCTAGTGCAGTTACCTTCAGGCCAAACTGTCCA
TGTCCAGGGAGTAATTCCGACACCACAGCCATCGATTATTCAGTCACCACAAATACAAACTGTTCAGGTAGCAACAATTGCAGAGACAGATGAGTCTGCA
GAATCAGAAGGTGTAATTGACTCTCATAAACGTAGAGAAATCCTGTCACGAAGACCTTCTTAT---AAAATACTGAATGAACTTTCCTCTGATGTGCCTG
GTGTTCCCAAGATTGAAGAAGAAAAATCAGAGGAAGAAGGAACGCCACCTAATATCGCTGCCATGGCAGTGCCGACTAGCATATATCAGACTAGCACGGG
GCAATAC---GCTATAGCCCAAGGTGGAACAATCCAGATTTCTAACCCAGGATCTGATGGTGTTCAGGGACTGCAGGCATTAACAATGACAAATTCAGGA
GCTCCTCCGCCAGGTGCTACAATTGTACAGTACGCAGCACAGTCAGCTGATGGCACACAGCAGTTCTTTGTCCCAGGCAGCCAGGTGGTGGTTCAA---G
CCACTGGTGACATGCCGACTTATCAGATCCGAGCTCCGACTACTGCTTTGCCTCAGGGAGTGGTGATGGCTGCCTCTCCGGGAAGCCTGCACAGCCCCCA
GCAACTAGCAGAGGAGGCAACACGCAAACGAGAGCTGAGGCTAATGAAAAAC---GAAGCTGCTAAGGAATGTCGCCGTCGAAAGAAAGAGTATGTCAAG
TGTCTGGAGAGTCGGGTTGCAGTGCTGGAAGTTCAGAACAAGAAGCTCATAGAGGAACTGGAAACCCTGAAAGACATTTGCTCTCCTAAAACAGATTAGT
AG


>BGISUSP0000890148
MTMETIDSQQDGSIPDSVAESESAHMQMQTGQNSVPTLAQVSVAGSGTGRGSPAVTLVQLPSGQTVHVQGVIPTPQPSIIQSPQIQTVQVATIAETDESA
ESEGVIDSHKRREILSRRPSY-KILNELSSDVPGVPKIEEEKSEEEGTPPNIAAMAVPTSIYQTSTGQY-AIAQGGTIQISNPGSDGVQGLQALTMTNSG
APPPGATIVQYAAQSADGTQQFFVPGSQVVVQ-ATGDMPTYQIRAPTTALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKN-EAAKECRRRKKEYVK
CLESRVAVLEVQNKKLIEELETLKDICSPKTD**