Sequences
EST Library Info
che2Heart - RNA from China
cst1Stomach - RNA from China
nca1Newborn 115 days, cartillage
Clusters
Oligos
SNPs

Gene ID ENSG00000119689 (click for geneview)
Transcript ID ENST00000334220(link to ensembl)
Symbol DLST
Localtion Chromosome:14:74418372:74440196:1 band: 14q24.3
Description Dihydrolipoyllysine-residue succinyltransferase component of 2- oxoglutarate dehydrogenase complex, mitochondrial precursor (EC 2.3.1.61) (Dihydrolipoamide succinyltransferase component of 2- oxoglutarate dehydrogenase complex) (E2) (E2K). [Source:Uniprot/SWISSPROT;Acc:P36957]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------------------------------------><--------------------------------><--
-M--L--S--R--S--R--C--V--S--R--A--F--S--R--S--L--S--A--F--Q--K--G--N--C--P--L--G--R--R--S--L--P--G--
ATGCTGTCCCGATCCCGCTGTGTGTCTCGGGCGTTCAGCCGCTCGCTCTCCGCCTTCCAGAAGGGGAACTGCCCTCTAGGGAGACGTTCCCTGCCTGGGG
                                                               :::::::::::::::::::::::::::::::::   .
---------------------------------------------------------------GGGAACTGCCCTCTAGGGAGACGTTCCCTGCCT---A
----------------------------------------------------------------G--N--C--P--L--G--R--R--S--L--P-----

---------------------------------------------><---------------------------------------------------><
V--S--L--C--Q--G--P--G--Y--P--N--S--R--K--V--V--I--N--N--S--V--F--S--V--R--F--F--R--T--T--A--V--C--K
TCTCCTTATGCCAGGGACCAGGTTACCCTAACAGCAGGAAGGTTGTCATTAACAACAGTGTCTTCAGTGTTCGCTTTTTCAGAACTACAGCTGTATGCAA
::::::::::.::::::::::::::::::.:::::::::::.::   : .::::..:::::::: :.:::::: ::.:::::::::::::::::.:::  
TCTCCTTATGTCAGGGACCAGGTTACCCTGACAGCAGGAAGATT---AGCAACAGTAGTGTCTTGAATGTTCGATTCTTCAGAACTACAGCTGTGTGC--
I--S--L--C--Q--G--P--G--Y--P--D--S--R--K--I-----S--N--S--S--V--L--N--V--R--F--F--R--T--T--A--V--C---

-------------------------------------------------------------------------><-------------------------
--D--D--L--V--T--V--K--T--P--A--F--A--E--S--V--T--E--G--D--V--R--W--E--K--A--V--G--D--T--V--A--E--D-
GGATGACTTGGTTACAGTCAAAACCCCAGCGTTTGCAGAATCTGTCACAGAGGGAGATGTCAGGTGGGAGAAAGCTGTTGGAGACACAGTTGCAGAAGAT
 :::::. ::.:::::::::::::::::::.::::::::::::::::::::.:::::::::::::::::::::   :::::::::::::: ::.::::::
-GATGATGTGATTACAGTCAAAACCCCAGCATTTGCAGAATCTGTCACAGAAGGAGATGTCAGGTGGGAGAAA---GTTGGAGACACAGTGGCGGAAGAT
--D--D--V--I--T--V--K--T--P--A--F--A--E--S--V--T--E--G--D--V--R--W--E--K-----V--G--D--T--V--A--E--D-

-----------------------------><---------------------------------------------------------------------
-E--V--V--C--E--I--E--T--D--K--T--S--V--Q--V--P--S--P--A--N--G--V--I--E--A--L--L--V--P--D--G--G--K--
GAAGTGGTTTGTGAGATTGAAACTGACAAGACATCTGTGCAGGTTCCATCACCAGCAAATGGCGTGATTGAAGCTCTTTTGGTACCTGATGGGGGAAAAG
:::::::: :::::::::::::: ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::
GAAGTGGTGTGTGAGATTGAAACAGACAAGACATCTGTGCAGGTTCCATCACCAGCAAATGGCGTGATTGAAGCTCTTTTGGTACCCGATGGGGGAAAAG
-E--V--V--C--E--I--E--T--D--K--T--S--V--Q--V--P--S--P--A--N--G--V--I--E--A--L--L--V--P--D--G--G--K--

-----------------------------------------><---------------------------------------------------------
V--E--G--G--T--P--L--F--T--L--R--K--T--G--A--A--P--A--K--A--K--P--A--E--A--P--A--A--A--A--P--K--A--E
TCGAAGGAGGCACTCCACTTTTCACACTCAGGAAAACTGGTGCTGCTCCTGCTAAGGCCAAGCCGGCTGAAGCTCCTGCTGCTGCAGCCCCAAAAGCAGA
: :::::::::::::: :::::::::::::::::::::      ::::::::::::::::::::.:::::::::::::::::::::::::::::::::::
TAGAAGGAGGCACTCCTCTTTTCACACTCAGGAAAACT------GCTCCTGCTAAGGCCAAGCCAGCTGAAGCTCCTGCTGCTGCAGCCCCAAAAGCAGA
V--E--G--G--T--P--L--F--T--L--R--K--T--------A--P--A--K--A--K--P--A--E--A--P--A--A--A--A--P--K--A--E

-------------------------------------------------------------------------------------------------><-
--P--T--A--A--A--V--P--P--P-----A--A--P--I--P--T--Q--M--P--P--V--P--S--P--S--Q--P--P--S--G--K--P--V-
ACCTACAGCAGCGGCAGTTCCTCCCCCT---GCAGCACCCATACCCACTCAGATGCCACCGGTGCCCTCGCCCTCACAGCCTCCTTCTGGCAAACCTGTG
::::.:::.. :.:::::::::::.::.   ::::::.:.:: :::::::::::::::::.::::::::.:::.::::.::::.: ::.::::::::   
ACCTGCAGTGTCAGCAGTTCCTCCTCCCCCTGCAGCATCTATCCCCACTCAGATGCCACCAGTGCCCTCACCCCCACAACCTCTTACTAGCAAACCT---
--P--A--V--S--A--V--P--P--P--P--A--A--S--I--P--T--Q--M--P--P--V--P--S--P--P--Q--P--L--T--S--K--P----

--------------------------------------------------------------------------><------------------------
-S--A--V--K--P--T--V--A--P--P--L--A--E--P--G--A--G--K--G--L--R--S--E--H--R--E--K--M--N--R--M--R--Q--
TCTGCAGTAAAACCCACTGTTGCCCCACCACTAGCTGAGCCAGGAGCTGGCAAAGGTCTGCGTTCAGAACATCGGGAGAAAATGAACAGGATGCGGCAGC
:::::::::::::::::::.:::::: ::: :::::::::: ::::::: :::.::::::::.:::::::::::::::::::::::::::::::::::::
TCTGCAGTAAAACCCACTGCTGCCCCTCCAGTAGCTGAGCCCGGAGCTGTCAAGGGTCTGCGCTCAGAACATCGGGAGAAAATGAACAGGATGCGGCAGC
-S--A--V--K--P--T--A--A--P--P--V--A--E--P--G--A--V--K--G--L--R--S--E--H--R--E--K--M--N--R--M--R--Q--

------------------------------------------------------------------------><--------------------------
R--I--A--Q--R--L--K--E--A--Q--N--T--C--A--M--L--T--T--F--N--E--I--D--M--S--N--I--Q--E--M--R--A--R--H
GCATTGCTCAGCGTCTGAAGGAGGCCCAGAATACATGTGCAATGCTGACAACTTTTAATGAGATTGACATGAGTAACATCCAGGAGATGAGGGCTCGGCA
::::.::::::::::::::::::::::::::.:: ::.::.::::: :: :::::.:::::::::::::::   ::::::::::: ::::::::::::::
GCATCGCTCAGCGTCTGAAGGAGGCCCAGAACACCTGCGCGATGCTCACCACTTTCAATGAGATTGACATG---AACATCCAGGACATGAGGGCTCGGCA
R--I--A--Q--R--L--K--E--A--Q--N--T--C--A--M--L--T--T--F--N--E--I--D--M-----N--I--Q--D--M--R--A--R--H

----------------------------------------------------------------------------------------------------
--K--E--A--F--L--K--K--H--N--L--K--L--G--F--M--S--A--F--V--K--A--S--A--F--A--L--Q--E--Q--P--V--V--N-
CAAAGAGGCTTTTTTGAAGAAACATAACCTCAAACTAGGCTTCATGTCGGCATTTGTGAAGGCCTCAGCCTTTGCCTTGCAGGAACAGCCTGTTGTAAAT
::::::.::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::.:::::::::::::::
CAAAGAAGCTTTTCTGAAGAAACATAACCTCAAACTAGGCTTCATGTCGGCATTTGTGAAGGCCTCAGCCTTCGCCTTGCAGGAGCAGCCTGTTGTAAAT
--K--E--A--F--L--K--K--H--N--L--K--L--G--F--M--S--A--F--V--K--A--S--A--F--A--L--Q--E--Q--P--V--V--N-

---><------------------------------------------------------------------------><---------------------
-A--V--I--D--D--T--T--K--E--V--V--Y--R--D--Y--I--D--I--S--V--A--V--A--T--P--R--G--L--V--V--P--V--I--
GCAGTGATTGACGACACAACCAAAGAGGTGGTGTATAGGGATTATATTGACATCAGTGTTGCAGTGGCCACCCCACGGGGTCTGGTGGTTCCAGTCATCA
:::   ::: :.::.:::::::::::::::::::::::::::::::::::::::::.::.:::::::::::::: ::::::::::::::::: :::::::
GCA---ATTTATGATACAACCAAAGAGGTGGTGTATAGGGATTATATTGACATCAGCGTCGCAGTGGCCACCCCTCGGGGTCTGGTGGTTCCCGTCATCA
-A-----I--Y--D--T--T--K--E--V--V--Y--R--D--Y--I--D--I--S--V--A--V--A--T--P--R--G--L--V--V--P--V--I--

-------------------------------------------------------------><-------------------------------------
R--N--V--E--A--M--N--F--A--D--I--E--R--T--I--T--E--L--G--E--K--A--R--K--N--E--L--A--I--E--D--M--D--G
GGAATGTGGAAGCTATGAATTTTGCAGATATTGAACGGACCATCACTGAACTGGGAGAGAAGGCCCGAAAGAATGAACTTGCCATTGAAGATATGGATGG
:::::::::::.::::::::: .:: ::::::::.::.::::::: ::::::::::::::::::: ::::::::::::::::.:::::::::::::::::
GGAATGTGGAAACTATGAATTACGCCGATATTGAGCGAACCATCAGTGAACTGGGAGAGAAGGCCAGAAAGAATGAACTTGCTATTGAAGATATGGATGG
R--N--V--E--T--M--N--Y--A--D--I--E--R--T--I--S--E--L--G--E--K--A--R--K--N--E--L--A--I--E--D--M--D--G

----------------------------------------------------------------------------------------------------
--G--T--F--T--I--S--N--G--G--V--F--G--S--L--F--G--T--P--I--I--N--P--P--Q--S--A--I--L--G--M--H--G--I-
CGGTACCTTCACCATTAGCAATGGAGGCGTTTTTGGCTCGCTCTTTGGAACACCCATTATCAACCCCCCTCAGTCTGCCATCCTGGGGATGCATGGCATC
.::.::.::::::::.:::::::::::::::::.::::: :::::::::::.:::::.::::::::::: ::::::::::::::::: :::::.: ::::
TGGCACTTTCACCATCAGCAATGGAGGCGTTTTCGGCTCCCTCTTTGGAACGCCCATCATCAACCCCCCGCAGTCTGCCATCCTGGGCATGCACGCCATC
--G--T--F--T--I--S--N--G--G--V--F--G--S--L--F--G--T--P--I--I--N--P--P--Q--S--A--I--L--G--M--H--A--I-

-----------------------------><---------------------------------------------------------------------
-F--D--R--P--V--A--I--G--G--K--V--E--V--R--P--M--M--Y--V--A--L--T--Y--D--H--R--L--I--D--G--R--E--A--
TTTGACAGGCCAGTGGCTATAGGAGGCAAGGTAGAGGTGCGGCCCATGATGTACGTGGCACTGACCTATGATCACCGGCTGATTGATGGCAGAGAGGCTG
 ::::.:::::::::::..:.:::::::::::.:::.:.:::::::::::::::::::: ::::: :::::::::::::::::.::.::.::::::::.:
GTTGATAGGCCAGTGGCCGTGGGAGGCAAGGTGGAGATACGGCCCATGATGTACGTGGCCCTGACGTATGATCACCGGCTGATCGACGGTAGAGAGGCCG
-V--D--R--P--V--A--V--G--G--K--V--E--I--R--P--M--M--Y--V--A--L--T--Y--D--H--R--L--I--D--G--R--E--A--

---------------------------------------------------------------->
V--T--F--L--R--K--I--K--A--A--V--E--D--P--R--V--L--L--L--D--L--*-
TGACTTTCCTCCGCAAAATCAAGGCAGCGGTAGAGGATCCCAGAGTCCTCCTCCTGGATCTTTAG
:.:::::::::::::::::::::::::::::::::::::::::::::::::: :::::.::::::
TAACTTTCCTCCGCAAAATCAAGGCAGCGGTAGAGGATCCCAGAGTCCTCCTACTGGACCTTTAG
V--T--F--L--R--K--I--K--A--A--V--E--D--P--R--V--L--L--L--D--L--*-

Pig Consensus Sequence

>BGISUST0000888740
---------------------------------------------------------------GGGAACTGCCCTCTAGGGAGACGTTCCCTGCCT---A
TCTCCTTATGTCAGGGACCAGGTTACCCTGACAGCAGGAAGATT---AGCAACAGTAGTGTCTTGAATGTTCGATTCTTCAGAACTACAGCTGTGTGC--
-GATGATGTGATTACAGTCAAAACCCCAGCATTTGCAGAATCTGTCACAGAAGGAGATGTCAGGTGGGAGAAA---GTTGGAGACACAGTGGCGGAAGAT
GAAGTGGTGTGTGAGATTGAAACAGACAAGACATCTGTGCAGGTTCCATCACCAGCAAATGGCGTGATTGAAGCTCTTTTGGTACCCGATGGGGGAAAAG
TAGAAGGAGGCACTCCTCTTTTCACACTCAGGAAAACT------GCTCCTGCTAAGGCCAAGCCAGCTGAAGCTCCTGCTGCTGCAGCCCCAAAAGCAGA
ACCTGCAGTGTCAGCAGTTCCTCCTCCCCCTGCAGCATCTATCCCCACTCAGATGCCACCAGTGCCCTCACCCCCACAACCTCTTACTAGCAAA---TCT
GCAGTAAAACCCACTGCTGCCCCTCCAGTAGCTGAGCCCGGAGCTGTCAAGGGTCTGCGCTCAGAACATCGGGAGAAAATGAACAGGATGCGGCAGCGCA
TCGCTCAGCGTCTGAAGGAGGCCCAGAACACCTGCGCGATGCTCACCACTTTCAATGAGATTGACATG---AACATCCAGGACATGAGGGCTCGGCACAA
AGAAGCTTTTCTGAAGAAACATAACCTCAAACTAGGCTTCATGTCGGCATTTGTGAAGGCCTCAGCCTTCGCCTTGCAGGAGCAGCCTGTTGTAAATGCA
---ATTTATGATACAACCAAAGAGGTGGTGTATAGGGATTATATTGACATCAGCGTCGCAGTGGCCACCCCTCGGGGTCTGGTGGTTCCCGTCATCAGGA
ATGTGGAAACTATGAATTACGCCGATATTGAGCGAACCATCAGTGAACTGGGAGAGAAGGCCAGAAAGAATGAACTTGCTATTGAAGATATGGATGGTGG
CACTTTCACCATCAGCAATGGAGGCGTTTTCGGCTCCCTCTTTGGAACGCCCATCATCAACCCCCCGCAGTCTGCCATCCTGGGCATGCACGCCATCGTT
GATAGGCCAGTGGCCGTGGGAGGCAAGGTGGAGATACGGCCCATGATGTACGTGGCCCTGACGTATGATCACCGGCTGATCGACGGTAGAGAGGCCGTAA
CTTTCCTCCGCAAAATCAAGGCAGCGGTAGAGGATCCCAGAGTCCTCCTACTGGACCTTTAG


>BGISUSP0000888740
---------------------GNCPLGRRSLP-ISLCQGPGYPDSRKI-SNSSVLNVRFFRTTAVC-DDVITVKTPAFAESVTEGDVRWEK-VGDTVAED
EVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKT--APAKAKPAEAPAAAAPKAEPAVSAVPPPPAASIPTQMPPVPSPPQPLTSK-S
AVKPTAAPPVAEPGAVKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDM-NIQDMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNA
-IYDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVETMNYADIERTISELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHAIV
DRPVAVGGKVEIRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL*