Sequences
EST Library Info
cut1Uterus - RNA from China
ese1Foetus 50 days, M. semitendinosus
Clusters
Oligos
SNPs

Gene ID ENSG00000186166 (click for geneview)
Transcript ID ENST00000334418(link to ensembl)
Symbol NP_940891.1
Localtion Chromosome:11:118374062:118391665:1 band: 11q23.3
Description similar to DLNB14
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--P--A--Q--R--C--P--L--C--R--Q--T--F--F--C--G--R--G--H--V--Y--S--R--K--H--Q--R--Q--L--K--E--A--
ATGGCGCCGGCGCAGCGCTGCCCTCTGTGCCGCCAGACCTTCTTCTGTGGTCGCGGGCACGTTTACAGCCGCAAGCACCAGCGGCAGCTGAAGGAGGCTT
:::::::::::::::::::::::::: :::::::::::.::::::::.::::::::::::::.::::::::::::::::::::::::.:::::: :::::
ATGGCGCCGGCGCAGCGCTGCCCTCTTTGCCGCCAGACTTTCTTCTGCGGTCGCGGGCACGTCTACAGCCGCAAGCACCAGCGGCAGTTGAAGGTGGCTT
-M--A--P--A--Q--R--C--P--L--C--R--Q--T--F--F--C--G--R--G--H--V--Y--S--R--K--H--Q--R--Q--L--K--V--A--

-------------------><-------------------------------------------------------------------------------
L--E--R--L--L--P--Q--V--E--A--A--R--K--A--I--R--A--A--Q--V--E--R--Y--V--P--E--H--E--R--C--C--W--C--L
TGGAGAGGCTCCTGCCCCAGGTGGAGGCGGCCCGCAAGGCCATCCGCGCCGCTCAGGTGGAGCGCTATGTGCCCGAACACGAGCGATGCTGCTGGTGCCT
::::: :::::.:::: :::::.::::: ::::::::::: :::::::::::::::::::::::.::.::::::::.::::::::  :::::::::::::
TGGAGCGGCTCTTGCCGCAGGTAGAGGCTGCCCGCAAGGCGATCCGCGCCGCTCAGGTGGAGCGTTACGTGCCCGAGCACGAGCGCAGCTGCTGGTGCCT
L--E--R--L--L--P--Q--V--E--A--A--R--K--A--I--R--A--A--Q--V--E--R--Y--V--P--E--H--E--R--S--C--W--C--L

-----------------------------------------------------------------------------------><---------------
--C--C--G--C--E--V--R--E--H--L--S--H--G--N--L--T--V--L--Y--G--G--L--L--E--H--L--A--S--P--E--H--K--K-
GTGCTGCGGCTGTGAGGTGCGGGAACACCTGAGCCATGGAAACCTGACGGTGCTGTACGGGGGGCTGCTGGAGCATCTGGCCAGCCCAGAGCACAAGAAA
:::::::::.::::::::::::.:::::::::::::.::::::::::: ::::::.:::::::::: :::::::::::::::   :::::::::::::::
GTGCTGCGGTTGTGAGGTGCGGAAACACCTGAGCCACGGAAACCTGACCGTGCTGCACGGGGGGCTCCTGGAGCATCTGGCC---CCAGAGCACAAGAAA
--C--C--G--C--E--V--R--K--H--L--S--H--G--N--L--T--V--L--H--G--G--L--L--E--H--L--A-----P--E--H--K--K-

----------------------------------------------------------------------------------><----------------
-A--T--N--K--F--W--W--E--N--K--A--E--V--Q--M--K--E--K--F--L--V--T--P--Q--D--Y--A--R--F--K--K--S--M--
GCAACCAACAAATTCTGGTGGGAGAACAAAGCTGAGGTCCAGATGAAAGAGAAGTTTCTGGTCACTCCCCAGGATTATGCGCGATTCAAGAAATCCATGG
:::::::::::::::::::::::::::::.:::::: :::::::::::::::::::::::.:: :.::::::::::::      ::::::::.:::::::
GCAACCAACAAATTCTGGTGGGAGAACAAGGCTGAGTTCCAGATGAAAGAGAAGTTTCTGATCTCCCCCCAGGATTAT------TTCAAGAAGTCCATGG
-A--T--N--K--F--W--W--E--N--K--A--E--F--Q--M--K--E--K--F--L--I--S--P--Q--D--Y--------F--K--K--S--M--

-------------------------------------------------><-------------------------------------------------
V--K--G--L--D--S--Y--E--E--K--E--D--K--V--I--K--E--M--A--A--Q--I--R--E--V--E--Q--S--R--Q--E--V--V--R
TGAAAGGTTTGGATTCCTATGAAGAAAAGGAGGATAAAGTGATCAAGGAGATGGCAGCTCAGATCCGTGAGGTGGAGCAGAGCCGACAGGAGGTGGTTCG
:.::::::::::::::::::::.:::::.::::::.:.::::::::.:::::::::::::::::::::::::..::::: :::::.::::::::::::::
TAAAAGGTTTGGATTCCTATGAGGAAAAAGAGGATGAGGTGATCAAAGAGATGGCAGCTCAGATCCGTGAGGCAGAGCACAGCCGGCAGGAGGTGGTTCG
V--K--G--L--D--S--Y--E--E--K--E--D--E--V--I--K--E--M--A--A--Q--I--R--E--A--E--H--S--R--Q--E--V--V--R

------------><---------------------------------------------------------------><---------------------
--S--V--L--E--P--Q--A--V--P--D--P--E--E--G--S--S--A--P--R--S--W--K--G--M--N--S--Q--V--A--S--S--L--Q-
GTCTGTCTTAGAGCCTCAGGCAGTGCCAGACCCAGAAGAGGGCTCTTCAGCACCTAGAAGCTGGAAAGGGATGAACAGCCAAGTAGCTTCCAGCTTACAG
 ::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::: ::::::::.:..:::   ::::::::.:: . ::.::::
TTCTGTCTTAGAGCCTCAGGCAGTGCCAGACCCAGAAGAGGGCTCTTCAGCACCTGGAAGGTGGAAAGGAACAAAC---CAAGTAGCCTCGGCCTCACAG
--S--V--L--E--P--Q--A--V--P--D--P--E--E--G--S--S--A--P--G--R--W--K--G--T--N-----Q--V--A--S--A--S--Q-

-----------------------------------------------------------------------------------><---------------
-Q--P--S--N--L--D--L--P--P--A--P--E--L--D--W--M--E--T--G--P--S--L--T--F--I--G--H--Q--D--I--P--G--V--
CAGCCCTCAAATTTGGACCTGCCACCAGCTCCAGAGCTTGACTGGATGGAGACAGGACCATCTCTGACATTCATTGGCCATCAGGATATACCAGGAGTTG
:::.::::: :.:::.:.:::::::::::.:: ::::::::::::::::::::::::: :.:::::::::::::::::::.:::                
CAGTCCTCATACTTGAATCTGCCACCAGCCCCCGAGCTTGACTGGATGGAGACAGGACAACCTCTGACATTCATTGGCCACCAG----------------
-Q--S--S--Y--L--N--L--P--P--A--P--E--L--D--W--M--E--T--G--Q--P--L--T--F--I--G--H--Q-----------------

--------------><------------------------------------------------------------------------------------
G--N--I--H--S--G--A--T--P--P--W--M--I--Q--D--E--E--Y--I--A--G--N--Q--E--I--G--P--S--Y--E--E--F--L--K
GTAACATCCACTCAGGTGCCACACCTCCCTGGATGATCCAAGATGAAGAATACATTGCTGGGAACCAAGAAATAGGACCATCCTATGAAGAATTTCTTAA
                 ::::::::::::::::::.::::::::::.:::::.: . ::::.:.:::: :::::::::: :::::::::::.::::::::
-----------------GCCACACCTCCCTGGATGGTCCAAGATGAGGAATATAGCTCTGGAAGCCAACAAATAGGACCCTCCTATGAAGAGTTTCTTAA
------------------A--T--P--P--W--M--V--Q--D--E--E--Y--S--S--G--S--Q--Q--I--G--P--S--Y--E--E--F--L--K

----><----------------------------------------------------------------------------------------------
--E--K--E--K--Q--K--L--K--K--L--P--P--D--R--V--G--A--N--F--D--H--S--S--R--T--S--A--G--W--L--P--S--F-
AGAAAAGGAAAAACAGAAGTTGAAAAAACTCCCCCCAGACCGAGTTGGGGCCAACTTTGATCACAGCTCCAGGACCAGTGCAGGCTGGCTGCCCTCTTTT
::::   :::::::::::::::::.:::::::: :::::: ::::::::::.::::::::.:::::.::::: :::.:::: :::::::::::::::::.
AGAA---GAAAAACAGAAGTTGAAGAAACTCCCACCAGACAGAGTTGGGGCTAACTTTGACCACAGTTCCAGTACCGGTGCTGGCTGGCTGCCCTCTTTC
--E-----E--K--Q--K--L--K--K--L--P--P--D--R--V--G--A--N--F--D--H--S--S--S--T--G--A--G--W--L--P--S--F-

-------------------------------------><----------------------------------------------------------->
-G--R--V--W--N--N--G--R--R--W--Q--S--R--H--Q--F--K--T--E--A--A--A--M--K--K--Q--S--H--T--E--K--S--*-
GGCCGCGTCTGGAATAATGGACGCCGCTGGCAGTCCAGACATCAATTCAAAACTGAAGCTGCAGCAATGAAGAAGCAGTCACATACAGAAAAAAGCTAA
::::: :::::::::::.::::::::::::::.:::                                                               
GGCCGGGTCTGGAATAACGGACGCCGCTGGCAATCC---------------------------------------------------------------
-G--R--V--W--N--N--G--R--R--W--Q--S----------------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000881778
ATGGCGCCGGCGCAGCGCTGCCCTCTTTGCCGCCAGACTTTCTTCTGCGGTCGCGGGCACGTCTACAGCCGCAAGCACCAGCGGCAGTTGAAGGTGGCTT
TGGAGCGGCTCTTGCCGCAGGTAGAGGCTGCCCGCAAGGCGATCCGCGCCGCTCAGGTGGAGCGTTACGTGCCCGAGCACGAGCGCAGCTGCTGGTGCCT
GTGCTGCGGTTGTGAGGTGCGGAAACACCTGAGCCACGGAAACCTGACCGTGCTGCACGGGGGGCTCCTGGAGCATCTGGCC---CCAGAGCACAAGAAA
GCAACCAACAAATTCTGGTGGGAGAACAAGGCTGAGTTCCAGATGAAAGAGAAGTTTCTGATCTCCCCCCAGGATTAT------TTCAAGAAGTCCATGG
TAAAAGGTTTGGATTCCTATGAGGAAAAAGAGGATGAGGTGATCAAAGAGATGGCAGCTCAGATCCGTGAGGCAGAGCACAGCCGGCAGGAGGTGGTTCG
TTCTGTCTTAGAGCCTCAGGCAGTGCCAGACCCAGAAGAGGGCTCTTCAGCACCTGGAAGGTGGAAAGGAACAAAC---CAAGTAGCCTCGGCCTCACAG
CAGTCCTCATACTTGAATCTGCCACCAGCCCCCGAGCTTGACTGGATGGAGACAGGACAACCTCTGACATTCATTGGCCACCAG----------------
-----------------GCCACACCTCCCTGGATGGTCCAAGATGAGGAATATAGCTCTGGAAGCCAACAAATAGGACCCTCCTATGAAGAGTTTCTTAA
AGAA---GAAAAACAGAAGTTGAAGAAACTCCCACCAGACAGAGTTGGGGCTAACTTTGACCACAGTTCCAGTACCGGTGCTGGCTGGCTGCCCTCTTTC
GGCCGGGTCTGGAATAACGGACGCCGCTGGCAATCC---------------------------------------------------------------


>BGISUSP0000881778
MAPAQRCPLCRQTFFCGRGHVYSRKHQRQLKVALERLLPQVEAARKAIRAAQVERYVPEHERSCWCLCCGCEVRKHLSHGNLTVLHGGLLEHLA-PEHKK
ATNKFWWENKAEFQMKEKFLISPQDY--FKKSMVKGLDSYEEKEDEVIKEMAAQIREAEHSRQEVVRSVLEPQAVPDPEEGSSAPGRWKGTN-QVASASQ
QSSYLNLPPAPELDWMETGQPLTFIGHQ-----------ATPPWMVQDEEYSSGSQQIGPSYEEFLKE-EKQKLKKLPPDRVGANFDHSSSTGAGWLPSF
GRVWNNGRRWQS---------------------