Sequences
EST Library Info
nje1Newborn 115 days, jejunum
Clusters
Oligos
SNPs

Gene ID ENSG00000187097 (click for geneview)
Transcript ID ENST00000334696(link to ensembl)
Symbol ENTPD5
Localtion Chromosome:14:73502936:73552387:-1 band: 14q24.3
Description Ectonucleoside triphosphate diphosphohydrolase 5 precursor (EC 3.6.1.6) (NTPDase5) (Nucleoside diphosphatase) (CD39 antigen-like 4) (ER-UDPase). [Source:Uniprot/SWISSPROT;Acc:O75356]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--T--S--W--G--T--V--F--F--M--L--V--V--S--C--V--C--S--A--V--S--H--R--N--Q--Q--T--W--F--E--G--I--
ATGGCCACTTCTTGGGGCACAGTCTTTTTCATGCTGGTGGTATCCTGTGTTTGCAGCGCTGTCTCCCACAGGAACCAGCAGACTTGGTTTGAGGGTATCT
:::: ::::::.::::: ::::.:::::::::::::::.:.::::::.:::::::::.::::::.::::::..:::::::::::::::::::::::::::
ATGGGCACTTCCTGGGGGACAGCCTTTTTCATGCTGGTAGCATCCTGCGTTTGCAGCACTGTCTTCCACAGAGACCAGCAGACTTGGTTTGAGGGTATCT
-M--G--T--S--W--G--T--A--F--F--M--L--V--A--S--C--V--C--S--T--V--F--H--R--D--Q--Q--T--W--F--E--G--I--

----------------------------------------------------------------------------------------------------
F--L--S--S--M--C--P--I--N--V--S--A--S--T--L--Y--G--I--M--F--D--A--G--S--T--G--T--R--I--H--V--Y--T--F
TCCTGTCTTCCATGTGCCCCATCAATGTCAGCGCCAGCACCTTGTATGGAATTATGTTTGATGCAGGGAGCACTGGAACTCGAATTCATGTTTACACCTT
::.::::::::::::::::::::::::::::.::::::::::: :::::::::::::::::::::::::::::.::::::::::::::::::::.:::::
TCTTGTCTTCCATGTGCCCCATCAATGTCAGTGCCAGCACCTTTTATGGAATTATGTTTGATGCAGGGAGCACCGGAACTCGAATTCATGTTTATACCTT
F--L--S--S--M--C--P--I--N--V--S--A--S--T--F--Y--G--I--M--F--D--A--G--S--T--G--T--R--I--H--V--Y--T--F

----------------><------------------------------------------------------------------------------><--
--V--Q--K--M--P--G--Q--L--P--I--L--E--G--E--V--F--D--S--V--K--P--G--L--S--A--F--V--D--Q--P--K--Q--G-
TGTGCAGAAAATGCCAGGACAGCTTCCAATTCTAGAAGGGGAAGTTTTTGATTCTGTGAAGCCAGGACTTTCTGCTTTTGTAGATCAACCTAAGCAGGGT
::::::::::::.:::      :::::::::::.:::::::::.::::::: ::::::::::::::::::::::::::::::::::::::::::::::::
TGTGCAGAAAATACCA------CTTCCAATTCTGGAAGGGGAAATTTTTGAATCTGTGAAGCCAGGACTTTCTGCTTTTGTAGATCAACCTAAGCAGGGT
--V--Q--K--I--P--------L--P--I--L--E--G--E--I--F--E--S--V--K--P--G--L--S--A--F--V--D--Q--P--K--Q--G-

----------------------------------------------------------------------------------------------------
-A--E--T--V--Q--G--L--L--E--V--A--K--D--S--I--P--R--S--H--W--K--K--T--P--V--V--L--K--A--T--A--G--L--
GCTGAGACCGTTCAAGGGCTCTTAGAGGTGGCCAAAGACTCAATCCCCCGAAGTCACTGGAAAAAGACCCCAGTGGTCCTAAAGGCAACAGCAGGACTAC
::::::::.:::::::..::::::::::::::::::::::: ::::::::::::::::::::.:..::::::::::::::.:::::::::::::::::.:
GCTGAGACTGTTCAAGAACTCTTAGAGGTGGCCAAAGACTCCATCCCCCGAAGTCACTGGAAGAGAACCCCAGTGGTCCTGAAGGCAACAGCAGGACTGC
-A--E--T--V--Q--E--L--L--E--V--A--K--D--S--I--P--R--S--H--W--K--R--T--P--V--V--L--K--A--T--A--G--L--

----------------------------------------><----------------------------------------------------------
R--L--L--P--E--H--K--A--K--A--L--L--F--E--V--K--E--I--F--R--K--S--P--F--L--V--P--K--G--S--V--S--I--M
GCTTACTGCCAGAACACAAAGCCAAGGCTCTGCTCTTTGAGGTAAAGGAGATCTTCAGGAAGTCACCTTTCCTGGTACCAAAGGGCAGTGTTAGCATCAT
::.::::::::::: : ::::::.:::::::::::::::::               :.::::::::::::::::::::::.  :.: :::::::::::::
GCCTACTGCCAGAAGAAAAAGCCGAGGCTCTGCTCTTTGAG---------------AAGAAGTCACCTTTCCTGGTACCAGTTGACTGTGTTAGCATCAT
R--L--L--P--E--E--K--A--E--A--L--L--F--E-----------------K--K--S--P--F--L--V--P--V--D--C--V--S--I--M

----------------><----------------------------------><----------------------------------------------
--D--G--S--D--E--G--I--L--A--W--V--T--V--N--F--L--T--G--Q--L--H--G--H--R--Q-----E--T--V--G-----T--L-
GGATGGATCCGACGAAGGCATATTAGCTTGGGTTACTGTGAATTTTCTGACAGGTCAGCTGCATGGCCACAGACAG---GAGACTGTGGGG---ACCTTG
:::::::::  :.:::                                       ::::::::::::::::: ::.   ::::::.: :::   :::.::
GGATGGATCGTATGAA---------------------------------------CAGCTGCATGGCCACAGCCAAG--GAGACTATTGGGG--ACCCTG
--D--G--S--Y--E-----------------------------------------Q--L--H--G--H--S--Q--\--E--T--I--G--\--T--L-

-----------------------------------------------><---------------------------------------------------
-D--L--G--G--A--S--T--Q--I--T--F--L--P--Q--F--E--K--T--L--E--Q--T--P--R--G--Y--L--T--S--F--E--M--F--
GACCTAGGGGGAGCCTCCACCCAAATCACGTTCCTGCCCCAGTTTGAGAAAACTCTGGAACAAACTCCTAGGGGCTACCTCACTTCCTTTGAGATGTTTA
:::::.:::::.:::::::::::::::::::::::::::::::: ::::::::.::::::::.::.:::::.:::::::: :::::::::::::::::::
GACCTGGGGGGGGCCTCCACCCAAATCACGTTCCTGCCCCAGTTAGAGAAAACCCTGGAACAGACCCCTAGAGGCTACCTAACTTCCTTTGAGATGTTTA
-D--L--G--G--A--S--T--Q--I--T--F--L--P--Q--L--E--K--T--L--E--Q--T--P--R--G--Y--L--T--S--F--E--M--F--

---------------------------><------------------------------------------------------------><---------
N--S--T--Y--K--L--Y--T--H--S--Y--L--G--F--G--L--K--A--A--R--L--A--T--L--G--A--L--E--T--E--G--T--D--G
ACAGCACTTATAAGCTCTATACACATAGTTACCTGGGATTTGGATTGAAAGCTGCAAGACTAGCAACCCTGGGAGCCCTGGAGACAGAAGGGACTGATGG
::::::::::::::::::::::::::   :::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::   :.::::::
ACAGCACTTATAAGCTCTATACACAT---TACTTGGGATTTGGATTGAAAGCTGCAAGACTAGCAACCCTGGGAGCCCTGGAGACAGAA---ATTGATGG
N--S--T--Y--K--L--Y--T--H-----Y--L--G--F--G--L--K--A--A--R--L--A--T--L--G--A--L--E--T--E-----I--D--G

-------------------------------------------------------------------------------------------><-------
--H--T--F--R--S--A--C--L--P--R--W--L--E--A--E--W--I--F--G--G--V--K--Y--Q--Y--G--G--N--Q--E--G--E--V-
GCACACTTTCCGGAGTGCCTGTTTACCGAGATGGTTGGAAGCAGAGTGGATCTTTGGGGGTGTGAAATACCAGTATGGTGGCAACCAAGAAGGGGAGGTG
.:::::::::::.:::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::   ::::::
ACACACTTTCCGAAGTGCCTGTCTACCGAGATGGTTGGAAGCAGAGTGGATCTTTGGGGGTGTGAAATACCAGTATGGTGGCAACCAAGAA---GAGGTG
--H--T--F--R--S--A--C--L--P--R--W--L--E--A--E--W--I--F--G--G--V--K--Y--Q--Y--G--G--N--Q--E-----E--V-

----------------------------------------------------------------------------------------------------
-G--F--E--P--C--Y--A--E--V--L--R--V--V--R--G--K--L--H--Q--P--E--E--V--Q--R--G--S--F--Y--A--F--S--Y--
GGCTTTGAGCCCTGCTATGCCGAAGTGCTGAGGGTGGTACGAGGAAAACTTCACCAGCCAGAGGAGGTCCAGAGAGGTTCCTTCTATGCTTTCTCTTACT
::::::::::::::.::.::.::::::::::::::::: :.::::::::::::.:::::::: ::::::::::::.:.::::::::::::::::::::::
GGCTTTGAGCCCTGTTACGCTGAAGTGCTGAGGGTGGTCCAAGGAAAACTTCATCAGCCAGATGAGGTCCAGAGAAGCTCCTTCTATGCTTTCTCTTACT
-G--F--E--P--C--Y--A--E--V--L--R--V--V--Q--G--K--L--H--Q--P--D--E--V--Q--R--S--S--F--Y--A--F--S--Y--

--------------------------------><-------------------------------------------------------><---------
Y--Y--D--R--A--V--D--T--D--M--I--D--Y--E--K--G--G--I--L--K--V--E--D--F--E--R--K--A--R--E--V--C--D--N
ATTATGACCGAGCTGTTGACACAGACATGATTGATTATGAAAAGGGGGGTATTTTAAAAGTTGAAGATTTTGAAAGAAAAGCCAGGGAAGTGTGTGATAA
:.::::::::::::::::::::::::::::::   ::::::::::: :::.::::::::::::: ::::::::::::::::: ::::::           
ACTATGACCGAGCTGTTGACACAGACATGATT---TATGAAAAGGGCGGTGTTTTAAAAGTTGACGATTTTGAAAGAAAAGCAAGGGAA-----------
Y--Y--D--R--A--V--D--T--D--M--I-----Y--E--K--G--G--V--L--K--V--D--D--F--E--R--K--A--R--E------------

----------------------------------------------------------------------------------------------------
--L--E--N--F--T--S--G--S--P--F--L--C--M--D--L--S--Y--I--T--A--L--L--K--D--G--F--G--F--A--D--S--T--V-
CTTGGAAAACTTCACCTCAGGCAGTCCTTTCCTGTGCATGGATCTCAGCTACATCACAGCCCTGTTAAAGGATGGCTTTGGCTTTGCAGACAGCACAGTC
          :: ..:::::::::::::::::::::::::::::::::.::::::::::::.:..:.::::::::::::::::::::::.:::.:: .::
----------TTGGTCTCAGGCAGTCCTTTCCTGTGCATGGATCTCAGTTACATCACAGCCTTACTGAAGGATGGCTTTGGCTTTGCAGGCAGTACCATC
-----------L--V--S--G--S--P--F--L--C--M--D--L--S--Y--I--T--A--L--L--K--D--G--F--G--F--A--G--S--T--I-

-----><------------------------------------------------------------------------------------->
-L--Q--L--T--K--K--V--N--N--I--E--T--G--W--A--L--G--A--T--F--H--L--L--Q--S--L--G--I--S--H--*-
TTACAGCTCACAAAGAAAGTGAACAACATAGAGACGGGCTGGGCCTTGGGGGCCACCTTTCACCTGTTGCAGTCTCTGGGCATCTCCCATTGA
:::::::: ::::::::::::::::::::::::::.:::::::::::::::::::::::.::::::.:.::::::::::::::::::::.:::
TTACAGCTGACAAAGAAAGTGAACAACATAGAGACAGGCTGGGCCTTGGGGGCCACCTTCCACCTGCTACAGTCTCTGGGCATCTCCCACTGA
-L--Q--L--T--K--K--V--N--N--I--E--T--G--W--A--L--G--A--T--F--H--L--L--Q--S--L--G--I--S--H--*-

Pig Consensus Sequence

>BGISUST0000891458
ATGGGCACTTCCTGGGGGACAGCCTTTTTCATGCTGGTAGCATCCTGCGTTTGCAGCACTGTCTTCCACAGAGACCAGCAGACTTGGTTTGAGGGTATCT
TCTTGTCTTCCATGTGCCCCATCAATGTCAGTGCCAGCACCTTTTATGGAATTATGTTTGATGCAGGGAGCACCGGAACTCGAATTCATGTTTATACCTT
TGTGCAGAAAATACCA------CTTCCAATTCTGGAAGGGGAAATTTTTGAATCTGTGAAGCCAGGACTTTCTGCTTTTGTAGATCAACCTAAGCAGGGT
GCTGAGACTGTTCAAGAACTCTTAGAGGTGGCCAAAGACTCCATCCCCCGAAGTCACTGGAAGAGAACCCCAGTGGTCCTGAAGGCAACAGCAGGACTGC
GCCTACTGCCAGAAGAAAAAGCCGAGGCTCTGCTCTTTGAG---------------AAGAAGTCACCTTTCCTGGTACCAGTTGACTGTGTTAGCATCAT
GGATGGATCGTATGAA---------------------------------------CAGCTGCATGGCCACAGCCAagAGACTATTGGgaCCCTGGACCTG
GGGGGGGCCTCCACCCAAATCACGTTCCTGCCCCAGTTAGAGAAAACCCTGGAACAGACCCCTAGAGGCTACCTAACTTCCTTTGAGATGTTTAACAGCA
CTTATAAGCTCTATACACAT---TACTTGGGATTTGGATTGAAAGCTGCAAGACTAGCAACCCTGGGAGCCCTGGAGACAGAA---ATTGATGGACACAC
TTTCCGAAGTGCCTGTCTACCGAGATGGTTGGAAGCAGAGTGGATCTTTGGGGGTGTGAAATACCAGTATGGTGGCAACCAAGAA---GAGGTGGGCTTT
GAGCCCTGTTACGCTGAAGTGCTGAGGGTGGTCCAAGGAAAACTTCATCAGCCAGATGAGGTCCAGAGAAGCTCCTTCTATGCTTTCTCTTACTACTATG
ACCGAGCTGTTGACACAGACATGATT---TATGAAAAGGGCGGTGTTTTAAAAGTTGACGATTTTGAAAGAAAAGCAAGGGAA-----------------
----TTGGTCTCAGGCAGTCCTTTCCTGTGCATGGATCTCAGTTACATCACAGCCTTACTGAAGGATGGCTTTGGCTTTGCAGGCAGTACCATCTTACAG
CTGACAAAGAAAGTGAACAACATAGAGACAGGCTGGGCCTTGGGGGCCACCTTCCACCTGCTACAGTCTCTGGGCATCTCCCACTGA


>BGISUSP0000891458
MGTSWGTAFFMLVASCVCSTVFHRDQQTWFEGIFLSSMCPINVSASTFYGIMFDAGSTGTRIHVYTFVQKIP--LPILEGEIFESVKPGLSAFVDQPKQG
AETVQELLEVAKDSIPRSHWKRTPVVLKATAGLRLLPEEKAEALLFE-----KKSPFLVPVDCVSIMDGSYE-------------QLHGHSQETIGTLDL
GGASTQITFLPQLEKTLEQTPRGYLTSFEMFNSTYKLYTH-YLGFGLKAARLATLGALETE-IDGHTFRSACLPRWLEAEWIFGGVKYQYGGNQE-EVGF
EPCYAEVLRVVQGKLHQPDEVQRSSFYAFSYYYDRAVDTDMI-YEKGGVLKVDDFERKARE-------LVSGSPFLCMDLSYITALLKDGFGFAGSTILQ
LTKKVNNIETGWALGATFHLLQSLGISH*