Sequences
BI340977est
rche15_b24.y1est
rpldo0113_h12.y1est
rspl20_l5.y1est
rova006_n10.y1est
rsme026_p5.y1est
CN030727est
CV864110est
rpigcb_0439.y1est
rcbr0_006961.y1est
CV878263est
DN837301est
rnlu1806b_o24.y1est
CO949515est
rfbs3926b_i19.y1est
rlnt02c_c20.y1est
CV876611est
reje14b_n16.y1est
rnco1905b_p17.y1est
rcbl0_015593.y1est
CV864631est
rsin02_e6.y1est
rfhi4015b_a15.y1est
BX927007est
rcki21_c21.y1est
AJ660100est
reje38b_m21.y1est
rhlv28b_b5.y1est
rcki34_b1.y1est
CX061795est
reep10c_e24.y1est
ruio33_p3.y1est
CX064959est
rpigca0_002453.y1est
CV868303est
DV224463est
rcst04_b11.y1est
AJ938228est
AB050333est
CN031304est
rpldo0103_p7.y1est
rpldo0137_o11.y1est
CO989002est
reye1610b_j17.y1est
reye1606b_h11r1.y1est
rpigca0_011671.y1est
rnje33c_m10.y1est
DY423388est
CD572435est
rcst01_p20.y1est
rpliv0106_a12.y1est
rvin020_o5.y1est
rfhi4029b_n6.y1est
CN026135est
CN030689est
rnbm01b_k13.y1est
BW966535est
CN025831est
CV865577est
rpigca0_010895.y1est
rmcp36c_g12.y1est
DN125016est
CN030768est
rfce10c_k24.y1est
CX059717est
rese26c_i10.y1est
rpliv0123_h2.y1est
CN030696est
CN030271est
rlnt14c_n8.y1est
rcbr0_002378.y1est
rpliv0109_j17.y1est
reye1604b_i23r1.y1est
rova022_a14.y1est
rpigcb_9482.y1est
CN025368est
rmed19c_d13.y1est
rpldo0139_o24.y1est
BX667427est
rssp05_f15.y1est
rcbl0_016680.y1est
CV867153est
DV227985est
rpigca0_006651.y1est
rfhi4013b_k7.y1est
CX063904est
rpgl10_b22.y1est
rsme031_p14.y1est
AJ658134est
CN025364est
AJ661090est
rpfat_19361.y1est
BX921795est
CB285973est
BP157117est
rese04c_f8.y1est
rste33_e6.y1est
CN031294est
CN030971est
rhyp08c_o16.y1est
BP154319est
rpldo0104_f22.y1est
rebs33c_g17.y1est
rnbm28b_k17.y1est
rspl40_o16.y1est
CB288229est
rfhi4039b_j6.y1est
BX914542est
rpliv0125_k3.y1est
rcje37_m4.y1est
AJ942346est
rpigca0_001829.y1est
rpgl29_j12.y1est
rpigcb_1477.y1est
AJ665960est
CN032288est
rova004_m6.y1est
recc2801c_j17.y1est
rpgl12_b15.y1est
CF179467est
CV864534est
BQ600885est
BE013367est
rcbr0_008185.y1est
rspl27_f18.y1est
CO989848est
rcbr0_016335.y1est
rspl01_e22.y1est
rmed10c_e3.y1est
rdbla0113_g7.y1est
CV871456est
BP147613est
rcbr0_014437.y1est
rcbr0_010952.y1est
CN025240est
AJ685618est
CV872234est
rpigca0_000545.y1est
CB475462est
CX062212est
CJ022526est
CV867521est
rcut16_i24.y1est
BP438366est
rfcc28b_c24.y1est
CK465632est
rnmm12c_h15.y1est
reje08b_d4.y1est
recc2831c_l14.y1est
rhyp07c_m17.y1est
rssp15_p3.y1est
rsme012_o13.y1est
rpfat_11991.y1est
rche29_l13.y1est
rspl15_n12.y1est
CN025721est
CV872812est
rpigca0_016048.y1est
rnbm14b_p10.y1est
rste26_h24.y1est
CN030285est
rsme33_b7.y1est
reje25b_o10.y1est
CV874527est
rcbr0_010618.y1est
CN031200est
BP464102est
CV877751est
CX060646est
AJ683619est
rhea32_b3.y1est
BE014385est
rpfat_13551.y1est
rsme37_j4.y1est
rcbl0_008555.y1est
rpliv0130_j9.y1est
CV864064est
rspl35_e21.y1est
rcad11b_n12.y1est
rpldo0139_o4.y1est
rnlu1801b_a12.y1est
CN026010est
rmcp13c_c9.y1est
AJ680235est
rssp04_c2.y1est
rsin14_i8.y1est
rssp27_j8.y1est
BW965064est
AJ746942est
rhlv04b_k13.y1est
CV875592est
rdbla0126_f23.y1est
rpigca0_002612.y1est
CX059615est
rpigca0_007909.y1est
CN032754est
rute2118b_h24.y1est
CO941564est
rcki016_f5.y1est
CN030884est
AJ747645est
reje09b_o8.y1est
rtra16_l4r1.y1est
rjca14c_l13.y1est
CB474678est
BP456781est
CV877971est
rcje35_h20.y1est
rpigcb_17976.y1est
BW965732est
rnlu1831b_g12.y1est
rpigcb_12715.y1est
rute2105b_e13.y1est
rute2109b_k16.y1est
rpliv0124_l20.y1est
rfbs3910b_c22.y1est
rnep19c_p9.y1est
rpldo0133_a7.y1est
CN032399est
rpigcb_11306.y1est
CX059009est
rpldo0118_e22.y1est
rcad07b_n14.y1est
rthg29_n21.y1est
rspl11_e18.y1est
BX665244est
recc2818c_d9.y1est
rcje18_b16.y1est
BF711107est
CX063884est
rcki04_h17.y1est
rfat0135_i14.y1est
rpigca0_003341.y1est
CV872597est
AJ687789est
rute2105b_c18.y1est
CV876263est
rhea19_g11.y1est
BX926585est
CV866204est
CN031203est
CX059799est
rjej39b_p8.y1est
rspl18_g16.y1est
rcsk09_h6.y1est
CV870268est
rspl32_a23.y1est
rcbr0_015969.y1est
rpigca0_010722.y1est
rpldo0120_e22.y1est
rfhi4011b_k22.y1est
CV870024est
CN032357est
rpgl18_c24.y1est
rhea16_l20.y1est
CF789716est
rfhi4002b_a5.y1est
rpldo0114_m8.y1est
CV870838est
CX065247est
CN030540est
rebs31c_d6.y1est
rtra13_b3r1.y1est
CV872700est
rcki30_m14.y1est
rnmm37c_k5.y1est
rvin009_j21.y1est
CN032177est
CN026045est
CN030529est
rfbs3912b_k4.y1est
rste29_a2.y1est
CV870270est
relu1322c_d19.y1est
rhyp30c_m24.y1est
CB286147est
rcbl0_006066.y1est
CV868913est
CV871761est
rpigcb_5380.y1est
CX057630est
rssp19_o19.y1est
CN032396est
CT247866reads
rmed04c_c11.y1est
rnlu1830b_e7.y1est
rste20_f4.y1est
rnlu1833b_k2.y1est
rsme31_p14.y1est
CV870097est
CB477444est
rpigca0_011094.y1est
BP158385est
rcut37_k22.y1est
CV865704est
rfcc25b_k9.y1est
rpigca0_016756.y1est
rpigca0_014737.y1est
CN031046est
rssp24_d16.y1est
CV872691est
rplun0125_i20.y1est
reep24c_o17.y1est
CN030524est
DN837552est
CN027294est
rsme032_j7.y1est
rpigca0_002277.y1est
BQ601428est
rebs30c_m13.y1est
CN025424est
AJ663792est
rsme010_f17.y1est
rche21_o7.y1est
rfbs3921b_f10.y1est
CN032764est
CX057815est
CN025670est
rpigca0_014952.y1est
rspl04_f3.y1est
rsme011_d3.y1est
CV864104est
CB483423est
rton1207b_o16.y1est
rplac__8872.y1est
rpfat_12106.y1est
rpgl21_d10.y1est
CX058047est
CV873194est
BI181045est
CN030286est
AW619216est
rbh_12846.y1reads
CV877459est
CO868703est
DY427404est
rcbr0_008423.y1est
CO952035est
CF180819est
CT065540reads
rdbla0104_d20.y1est
CV869532est
rnmm27c_m7.y1est
BF703454est
reye1611b_g14r1.y1est
rcje36_k8.y1est
rova004_d20.y1est
rpigcb_11127.y1est
rpgl13_j15.y1est
DV224545est
rste22_a11.y1est
rfcc03b_c17.y1est
rcbr0_002284.y1est
CV871634est
rpigca0_016895.y1est
rnep13c_n2.y1est
AJ682308est
rpliv0105_p9.y1est
rlnt13c_h24.y1est
CN032685est
relu1324c_l1.y1est
CV875764est
CB287676est
rese28c_c11.y1est
rfbs3937b_l2.y1est
rmcp28c_p13.y1est
rsin13_j21.y1est
rhea05_j18.y1est
CV870477est
CN027287est
CN030514est
rcbr0_011730.y1est
AJ666003est
rpigca0_005038.y1est
AJ681504est
CB285302est
rcbr0_007760.y1est
CN028228est
CX061345est
CV877678est
rcbr0_007784.y1est
rcbr0_002291.y1est
CB285304est
CV871898est
rlnt09c_b4.y1est
CN031008est
CN030570est
rcbr0_007303.y1est
rhyp03c_a19.y1est
rhea07_f4.y1est
rcut40_i11.y1est
recc2820c_m17.y1est
CN030075est
rpigcb_3892.y1est
AU055647est
AB050315est
rton1204b_h9.y1est
CV867499est
CN032683est
EST Library Info
cad2Unavailable
cbl5Blood
cbr15Brain - RNA from China
che6Heart - RNA from China
cje4Jejunum - RNA from China
cki6Kidney - RNA from China
csk2Skin - RNA from China
cst2Stomach - RNA from China
cut4Uterus - RNA from China
dbla4Unavailable
ebs5Foetus 50 days, brain stem
ecc7Foetus 50 days, cortex cerebri
eep3Foetus 50 days, epidermis
eje7Foetus 50 days, jejunum
elu1Foetus 50 days, lung
ese4Foetus 50 days, M. semitendinosus
eye7Foetus 50 days, Eye
fat5Fatt
fbs5Unavailable
fcc3Unavailable
fce2Foetus 100 days, cerebellum
fhi6Unavailable
hea8Heart
hlv2Heart, left ventricle
hyp4Hypothalamus
jca3Joint capsule
jej1Small intestine, jejunum
lnt6Lymphatic nodule tracheobroncalis
mcp4Mammae, collostrum producing
med4Mediastinum
nbm6Newborn 115 days, bone marrow (pelvis)
nep4Newborn 115 days, epidermis
nje1Newborn 115 days, jejunum
nlu6Newborn 115 days, lung
nmm7Newborn 115 days, mucosal membranes
ova6Ovary
pgl10Pituitary gland
pigca30Unavailable
pigcb15Unavailable
plac3Unavailable
pldo12Unavailable
pliv11Unavailable
plun1Unavailable
relu3Unavailable
sin3Small intestine
sme9M. Semimembranosus
spl13Spleen
ssp9M. Supraspinatus
ste9M. Semitendinosus
thg1Thyroid gland
ton1Tip of tongue, mucosal membrane
tra2Trachea
uio1Unavailable
ute7Uterus
vin2M. Vastus intermedius
Clusters
Oligos
SNPs

Gene ID ENSG00000080824 (click for geneview)
Transcript ID ENST00000334701(link to ensembl)
Symbol HSPCA
Localtion Chromosome:14:101617145:101623135:-1 band: 14q32.32
Description Heat shock protein HSP 90-alpha (HSP 86). [Source:Uniprot/SWISSPROT;Acc:P07900]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--P--E--E--T--Q--T--Q-----D--Q--P--M--E--E--E--E--V--E--T--F--A--F--Q--A--E--I--A--Q--L--M--S--L--
ATGCCTGAGGAAACCCAGACCCAA---GACCAACCGATGGAGGAGGAGGAGGTTGAGACGTTCGCCTTTCAGGCAGAAATTGCCCAGTTGATGTCATTGA
:::::.::::::::::::: :::.   :::::.:::::::::::::::::::: ::::::::::::::.:::::.:::::.::::::::::::::.::::
ATGCCCGAGGAAACCCAGAGCCAGA--GACCAGCCGATGGAGGAGGAGGAGGTGGAGACGTTCGCCTTCCAGGCGGAAATCGCCCAGTTGATGTCGTTGA
-M--P--E--E--T--Q--S--Q--\--D--Q--P--M--E--E--E--E--V--E--T--F--A--F--Q--A--E--I--A--Q--L--M--S--L--

----------------------------------------------------------------><----------------------------------
I--I--N--T--F--Y--S--N--K--E--I--F--L--R--E--L--I--S--N--S--S--D--A--L--D--K--I--R--Y--E--S--L--T--D
TCATCAATACTTTCTACTCGAACAAAGAGATCTTTCTGAGAGAGCTCATTTCAAATTCATCAGATGCATTGGACAAAATCCGGTATGAAAGCTTGACAGA
:::::::.:::::::::::::::::.::::::::::::::.::::::::::: ::.::.:: ::::: ::::::::.::: :.::.::::::.::::.::
TCATCAACACTTTCTACTCGAACAAGGAGATCTTTCTGAGGGAGCTCATTTCCAACTCGTCCGATGCTTTGGACAAGATCAGATACGAAAGCCTGACGGA
I--I--N--T--F--Y--S--N--K--E--I--F--L--R--E--L--I--S--N--S--S--D--A--L--D--K--I--R--Y--E--S--L--T--D

----------------------------------------------------------------------------------------------------
--P--S--K--L--D--S--G--K--E--L--H--I--N--L--I--P--N--K--Q--D--R--T--L--T--I--V--D--T--G--I--G--M--T-
TCCCAGTAAATTAGACTCTGGGAAAGAGCTGCATATTAACCTTATACCGAACAAACAAGATCGAACTCTCACTATTGTGGATACTGGAATTGGAATGACC
::::::::::.:::::::.::::::::::::::.:::::.::.:: ::::::::.:::::.::.::.::::: :: :::::.::.:: ::.:: ::::::
TCCCAGTAAACTAGACTCCGGGAAAGAGCTGCACATTAATCTCATTCCGAACAAGCAAGACCGGACCCTCACGATAGTGGACACCGGCATCGGCATGACC
--P--S--K--L--D--S--G--K--E--L--H--I--N--L--I--P--N--K--Q--D--R--T--L--T--I--V--D--T--G--I--G--M--T-

----------------------------------------------------------------------------------------------------
-K--A--D--L--I--N--N--L--G--T--I--A--K--S--G--T--K--A--F--M--E--A--L--Q--A--G--A--D--I--S--M--I--G--
AAGGCTGACTTGATCAATAACCTTGGTACTATCGCCAAGTCTGGGACCAAAGCGTTCATGGAAGCTTTGCAGGCTGGTGCAGATATCTCTATGATTGGCC
:::::.::::::::::::::::::::::: ::::::::::::::::::::.:::::::::::.:::::::::::.::::: :::::::: ::::::::::
AAGGCCGACTTGATCAATAACCTTGGTACGATCGCCAAGTCTGGGACCAAGGCGTTCATGGAGGCTTTGCAGGCCGGTGCCGATATCTCGATGATTGGCC
-K--A--D--L--I--N--N--L--G--T--I--A--K--S--G--T--K--A--F--M--E--A--L--Q--A--G--A--D--I--S--M--I--G--

----------------------------------------------------------------------------------------------------
Q--F--G--V--G--F--Y--S--A--Y--L--V--A--E--K--V--T--V--I--T--K--H--N--D--D--E--Q--Y--A--W--E--S--S--A
AGTTCGGTGTTGGTTTTTATTCTGCTTATTTGGTTGCTGAGAAAGTAACTGTGATCACCAAACATAACGATGATGAGCAGTACGCTTGGGAGTCCTCAGC
::::::::::.::.::.::.::::: ::..::::.:::::::::::.::.:: :::::::::::.::::::::.::::::::.::.::::::::.:: ::
AGTTCGGTGTCGGCTTCTACTCTGCGTACCTGGTCGCTGAGAAAGTGACCGTTATCACCAAACACAACGATGACGAGCAGTATGCCTGGGAGTCTTCTGC
Q--F--G--V--G--F--Y--S--A--Y--L--V--A--E--K--V--T--V--I--T--K--H--N--D--D--E--Q--Y--A--W--E--S--S--A

-------------------------------><-------------------------------------------------------------------
--G--G--S--F--T--V--R--T--D--T--G--E--P--M--G--R--G--T--K--V--I--L--H--L--K--E--D--Q--T--E--Y--L--E-
AGGGGGATCATTCACAGTGAGGACAGACACAGGTGAACCTATGGGTCGTGGAACAAAAGTTATCCTACACCTGAAAGAAGACCAAACTGAGTACTTGGAG
:::.::::: ::::: :: ::::::::::::   :::::::::::::::::::::::.:::::.:::::.:::::::::::::::::::::::::::::.
AGGAGGATCTTTCACCGTTAGGACAGACACA---GAACCTATGGGTCGTGGAACAAAGGTTATTCTACATCTGAAAGAAGACCAAACTGAGTACTTGGAA
--G--G--S--F--T--V--R--T--D--T-----E--P--M--G--R--G--T--K--V--I--L--H--L--K--E--D--Q--T--E--Y--L--E-

-----------------------------------------------------------------><---------------------------------
-E--R--R--I--K--E--I--V--K--K--H--S--Q--F--I--G--Y--P--I--T--L--F--V--E--K--E--R--D--K--E--V--S--D--
GAACGAAGAATAAAGGAGATTGTGAAGAAACATTCTCAGTTTATTGGATATCCCATTACTCTTTTTGTGGAGAAGGAACGTGATAAAGAAGTAAGCGATG
::: :.::::::::::::::::::::::::::.:::::::::::::: ::.:::::::::::.   :::::::::::::::::::::::::: ::.::.:
GAAAGGAGAATAAAGGAGATTGTGAAGAAACACTCTCAGTTTATTGGCTACCCCATTACTCTC---GTGGAGAAGGAACGTGATAAAGAAGTCAGTGACG
-E--R--R--I--K--E--I--V--K--K--H--S--Q--F--I--G--Y--P--I--T--L-----V--E--K--E--R--D--K--E--V--S--D--

----------------------------------------------------------------------------------------------------
D--E--A--E--E--K--E--D--K--E--E--E--K--E--K--E--E--K--E--S--E--D--K--P--E--I--E--D--V--G--S--D--E--E
ATGAGGCTGAAGAAAAGGAAGACAAAGAAGAAGAAAAAGAAAAAGAAGAGAAAGAGTCGGAAGACAAACCTGAAATTGAAGATGTTGGTTCTGATGAGGA
:.::::: ::::::::::::::::::::.::::::::.::.:::::::::::.::.:: ::.::.::::: ::.:: ::::::::::::::::::::.::
ACGAGGCGGAAGAAAAGGAAGACAAAGAGGAAGAAAAGGAGAAAGAAGAGAAGGAATCTGAGGATAAACCAGAGATAGAAGATGTTGGTTCTGATGAAGA
D--E--A--E--E--K--E--D--K--E--E--E--K--E--K--E--E--K--E--S--E--D--K--P--E--I--E--D--V--G--S--D--E--E

----------------------------------------------------------------------------------------------------
--E--E-----K--K--D--G--D--K--K--K--K--K--K--I--K--E--K--Y--I--D--Q--E--E--L--N--K--T--K--P--I--W--T-
AGAAGAA---AAGAAGGATGGTGACAAGAAGAAGAAGAAGAAGATTAAGGAAAAGTACATCGATCAAGAAGAGCTCAACAAAACAAAGCCCATCTGGACC
.::::::   :::::::::::::::::::::::::::::::::::.:::::.:::::.::.::::::::.::.::::::::.::::::::.::.::::::
GGAAGAAGAAAAGAAGGATGGTGACAAGAAGAAGAAGAAGAAGATCAAGGAGAAGTATATTGATCAAGAGGAACTCAACAAGACAAAGCCTATTTGGACC
--E--E--E--K--K--D--G--D--K--K--K--K--K--K--I--K--E--K--Y--I--D--Q--E--E--L--N--K--T--K--P--I--W--T-

--------------------------------------------------------------------------------------><------------
-R--N--P--D--D--I--T--N--E--E--Y--G--E--F--Y--K--S--L--T--N--D--W--E--D--H--L--A--V--K--H--F--S--V--
AGAAATCCCGACGATATTACTAATGAGGAGTACGGAGAATTCTATAAGAGCTTGACCAATGACTGGGAAGATCACTTGGCAGTGAAGCATTTTTCAGTTG
:::::.:::::.::.::.::::::::.::::::::.::.:::::::::::::::::::::::::::::.::::::::::: ::::::::.::::::::.:
AGAAACCCCGATGACATCACTAATGAAGAGTACGGGGAGTTCTATAAGAGCTTGACCAATGACTGGGAGGATCACTTGGCTGTGAAGCACTTTTCAGTCG
-R--N--P--D--D--I--T--N--E--E--Y--G--E--F--Y--K--S--L--T--N--D--W--E--D--H--L--A--V--K--H--F--S--V--

----------------------------------------------------------------------------------------------------
E--G--Q--L--E--F--R--A--L--L--F--V--P--R--R--A--P--F--D--L--F--E--N--R--K--K--K--N--N--I--K--L--Y--V
AAGGACAGTTGGAATTCAGAGCCCTTCTATTTGTCCCACGACGTGCTCCTTTTGATCTGTTTGAAAACAGAAAGAAAAAGAACAACATCAAATTGTATGT
::::.::::::::.:::::::::::::: ::.:::::: ::::.::::::::.::..:.:::::::::::::::::.::::::::::::::..:::::::
AAGGGCAGTTGGAGTTCAGAGCCCTTCTTTTCGTCCCAAGACGCGCTCCTTTCGACTTATTTGAAAACAGAAAGAAGAAGAACAACATCAAGCTGTATGT
E--G--Q--L--E--F--R--A--L--L--F--V--P--R--R--A--P--F--D--L--F--E--N--R--K--K--K--N--N--I--K--L--Y--V

----------------------------------------------------><----------------------------------------------
--R--R--V--F--I--M--D--N--C--E--E--L--I--P--E--Y--L--N--F--I--R--G--V--V--D--S--E--D--L--P--L--N--I-
ACGCAGAGTTTTCATCATGGATAACTGTGAGGAGCTAATCCCTGAATATCTGAACTTCATTAGAGGGGTGGTAGACTCGGAGGATCTCCCTCTAAACATA
 ::: :::: :::::::::::.:::::.:::::::: ::::::::.::::::   ::::::::::: :::::.::::: ::::::::::::::.::::: 
TCGCCGAGTGTTCATCATGGACAACTGCGAGGAGCTCATCCCTGAGTATCTG---TTCATTAGAGGCGTGGTGGACTCTGAGGATCTCCCTCTGAACATT
--R--R--V--F--I--M--D--N--C--E--E--L--I--P--E--Y--L-----F--I--R--G--V--V--D--S--E--D--L--P--L--N--I-

----------------------------------------------------------------------------------------------------
-S--R--E--M--L--Q--Q--S--K--I--L--K--V--I--R--K--N--L--V--K--K--C--L--E--L--F--T--E--L--A--E--D--K--
TCCCGTGAGATGTTGCAACAAAGCAAAATTTTGAAAGTTATCAGGAAGAATTTGGTCAAAAAATGCTTAGAACTCTTTACTGAACTGGCGGAAGATAAAG
::.:::::::::::::::::::::::::::::::::::.::::::::::::.:::::::.:::::::::::.::::::::::::.:::: ::::::::::
TCTCGTGAGATGTTGCAACAAAGCAAAATTTTGAAAGTCATCAGGAAGAATCTGGTCAAGAAATGCTTAGAGCTCTTTACTGAATTGGCCGAAGATAAAG
-S--R--E--M--L--Q--Q--S--K--I--L--K--V--I--R--K--N--L--V--K--K--C--L--E--L--F--T--E--L--A--E--D--K--

-------------------------------------------><-------------------------------------------------------
E--N--Y--K--K--F--Y--E--Q--F--S--K--N--I--K--L--G--I--H--E--D--S--Q--N--R--K--K--L--S--E--L--L--R--Y
AGAACTACAAGAAATTCTATGAGCAGTTCTCTAAAAACATAAAGCTTGGAATACACGAAGACTCTCAAAATCGGAAGAAGCTTTCAGAGCTGTTAAGGTA
::::.::::::::.:::::::::::::::::::::::.:: ::::::::::::::.:::::.::::::::::::::::::::::: ::::::::.:::::
AGAATTACAAGAAGTTCTATGAGCAGTTCTCTAAAAATATTAAGCTTGGAATACATGAAGATTCTCAAAATCGGAAGAAGCTTTCCGAGCTGTTGAGGTA
E--N--Y--K--K--F--Y--E--Q--F--S--K--N--I--K--L--G--I--H--E--D--S--Q--N--R--K--K--L--S--E--L--L--R--Y

-------------------------------------------------------------------------------------------><-------
--Y--T--S--A--S--G--D--E--M--V--S--L--K--D--Y--C--T--R--M--K--E--N--Q--K--H--I--Y--Y--I--T--G--E--T-
CTACACATCTGCCTCTGGTGATGAGATGGTTTCTCTCAAGGACTACTGCACCAGAATGAAGGAGAACCAGAAACATATCTATTATATCACAGGTGAGACC
:::::: :::::.:::::.::.:::::::::::.:::::::::::.:::::::::::::::::::::::::::::.::::::::.::::::   ::::::
CTACACTTCTGCTTCTGGCGACGAGATGGTTTCCCTCAAGGACTATTGCACCAGAATGAAGGAGAACCAGAAACACATCTATTACATCACA---GAGACC
--Y--T--S--A--S--G--D--E--M--V--S--L--K--D--Y--C--T--R--M--K--E--N--Q--K--H--I--Y--Y--I--T-----E--T-

----------------------------------------------------------------------------------------------------
-K--D--Q--V--A--N--S--A--F--V--E--R--L--R--K--H--G--L--E--V--I--Y--M--I--E--P--I--D--E--Y--C--V--Q--
AAGGACCAGGTAGCTAACTCAGCCTTTGTGGAACGTCTTCGGAAACATGGCTTAGAAGTGATCTATATGATTGAGCCCATTGATGAGTACTGTGTCCAAC
:::::::::::.::.:::::.:::::.::::::::::: :::::.::.:::.:.::.::::::::.:::::.::::::::.:::::::::::::: ::.:
AAGGACCAGGTGGCCAACTCGGCCTTCGTGGAACGTCTGCGGAAGCACGGCCTGGAGGTGATCTACATGATCGAGCCCATCGATGAGTACTGTGTGCAGC
-K--D--Q--V--A--N--S--A--F--V--E--R--L--R--K--H--G--L--E--V--I--Y--M--I--E--P--I--D--E--Y--C--V--Q--

----------------------------------------------------------------------------------------------------
Q--L--K--E--F--E--G--K--T--L--V--S--V--T--K--E--G--L--E--L--P--E--D--E--E--E--K--K--K--Q--E--E--K--K
AGCTGAAGGAATTTGAGGGGAAGACTTTAGTGTCAGTCACCAAAGAAGGCCTGGAACTTCCAGAGGATGAAGAAGAGAAAAAGAAGCAGGAAGAGAAAAA
::::::::::.::::::::::::::.::::::::::::::::::::.::::::::.::.::.::.::.:::::.:::::.:::::.:::::.:::::.::
AGCTGAAGGAGTTTGAGGGGAAGACCTTAGTGTCAGTCACCAAAGAGGGCCTGGAGCTCCCGGAAGACGAAGAGGAGAAGAAGAAACAGGAGGAGAAGAA
Q--L--K--E--F--E--G--K--T--L--V--S--V--T--K--E--G--L--E--L--P--E--D--E--E--E--K--K--K--Q--E--E--K--K

------------------------------------------------------------><--------------------------------------
--T--K--F--E--N--L--C--K--I--M--K--D--I--L--E--K--K--V--E--K--V--V--V--S--N--R--L--V--T--S--P--C--C-
AACAAAGTTTGAGAACCTCTGCAAAATCATGAAAGACATATTGGAGAAAAAAGTTGAAAAGGTGGTTGTGTCAAACCGATTGGTGACATCTCCATGCTGT
.:::::::::::.:::::::::::.::::::::.::::: ::::::::.::::: :::::::::::::::::.:::::.:::::::: :: ::::::::.
GACAAAGTTTGAAAACCTCTGCAAGATCATGAAGGACATCTTGGAGAAGAAAGTGGAAAAGGTGGTTGTGTCGAACCGGTTGGTGACCTCACCATGCTGC
--T--K--F--E--N--L--C--K--I--M--K--D--I--L--E--K--K--V--E--K--V--V--V--S--N--R--L--V--T--S--P--C--C-

----------------------------------------------------------------------------------------------------
-I--V--T--S--T--Y--G--W--T--A--N--M--E--R--I--M--K--A--Q--A--L--R--D--N--S--T--M--G--Y--M--A--A--K--
ATTGTCACAAGCACATATGGCTGGACAGCAAACATGGAGAGAATCATGAAAGCTCAAGCCCTAAGAGACAACTCAACAATGGGTTACATGGCAGCAAAGA
:::::::::::::::::.::::::::::::::::::::::::::::::::.:::::::::::.:::::::::::.:::::::::::::::::::::::::
ATTGTCACAAGCACATACGGCTGGACAGCAAACATGGAGAGAATCATGAAGGCTCAAGCCCTGAGAGACAACTCGACAATGGGTTACATGGCAGCAAAGA
-I--V--T--S--T--Y--G--W--T--A--N--M--E--R--I--M--K--A--Q--A--L--R--D--N--S--T--M--G--Y--M--A--A--K--

----------------------------------------------------------------------------------------------------
K--H--L--E--I--N--P--D--H--S--I--I--E--T--L--R--Q--K--A--E--A--D--K--N--D--K--S--V--K--D--L--V--I--L
AACACCTGGAGATAAACCCTGACCATTCCATTATTGAGACCTTAAGGCAAAAGGCAGAGGCTGATAAGAACGACAAGTCTGTGAAGGATCTGGTCATCTT
:.::::::::::::::.:: :::::::::::.::.::::::.:.::::::::::::::::: ::.::::::::::::::.::::::::::::::::::.:
AGCACCTGGAGATAAATCCAGACCATTCCATCATCGAGACCCTGAGGCAAAAGGCAGAGGCGGACAAGAACGACAAGTCCGTGAAGGATCTGGTCATCCT
K--H--L--E--I--N--P--D--H--S--I--I--E--T--L--R--Q--K--A--E--A--D--K--N--D--K--S--V--K--D--L--V--I--L

----------------------------------------------------------------------------------------------><----
--L--Y--E--T--A--L--L--S--S--G--F--S--L--E--D--P--Q--T--H--A--N--R--I--Y--R--M--I--K--L--G--L--G--I-
GCTTTATGAAACTGCGCTCCTGTCTTCTGGCTTCAGTCTGGAAGATCCCCAGACACATGCTAACAGGATCTACAGGATGATCAAACTTGGTCTGGGTATT
::: ::.:::::.:: :: :::::::::::::::::.:::::::::::::::::.::.::.::::::::::::::::::::::::::::::         
GCTGTACGAAACCGCTCTGCTGTCTTCTGGCTTCAGCCTGGAAGATCCCCAGACGCACGCCAACAGGATCTACAGGATGATCAAACTTGGT---------
--L--Y--E--T--A--L--L--S--S--G--F--S--L--E--D--P--Q--T--H--A--N--R--I--Y--R--M--I--K--L--G----------

----------------------------------------------------------------------------------------------------
-D--E--D--D--P--T--A--D--D--T--S--A--A--V--T--E--E--M--P--P--L--E--G--D--D--D--T--S--R--M--E--E--V--
GATGAAGATGACCCTACTGCTGATGATACCAGTGCTGCTGTAACTGAAGAAATGCCACCCCTTGAAGGAGATGACGACACATCACGCATGGAAGAAGTAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---->
D--*-
ACTAA
     
-----
-----

Pig Consensus Sequence

>BGISUST0000898375
ATGCCCGAGGAAACCCAGAGCCAggACCAGCCGATGGAGGAGGAGGAGGTGGAGACGTTCGCCTTCCAGGCGGAAATCGCCCAGTTGATGTCGTTGATCA
TCAACACTTTCTACTCGAACAAGGAGATCTTTCTGAGGGAGCTCATTTCCAACTCGTCCGATGCTTTGGACAAGATCAGATACGAAAGCCTGACGGATCC
CAGTAAACTAGACTCCGGGAAAGAGCTGCACATTAATCTCATTCCGAACAAGCAAGACCGGACCCTCACGATAGTGGACACCGGCATCGGCATGACCAAG
GCCGACTTGATCAATAACCTTGGTACGATCGCCAAGTCTGGGACCAAGGCGTTCATGGAGGCTTTGCAGGCCGGTGCCGATATCTCGATGATTGGCCAGT
TCGGTGTCGGCTTCTACTCTGCGTACCTGGTCGCTGAGAAAGTGACCGTTATCACCAAACACAACGATGACGAGCAGTATGCCTGGGAGTCTTCTGCAGG
AGGATCTTTCACCGTTAGGACAGACACA---GAACCTATGGGTCGTGGAACAAAGGTTATTCTACATCTGAAAGAAGACCAAACTGAGTACTTGGAAGAA
AGGAGAATAAAGGAGATTGTGAAGAAACACTCTCAGTTTATTGGCTACCCCATTACTCTC---GTGGAGAAGGAACGTGATAAAGAAGTCAGTGACGACG
AGGCGGAAGAAAAGGAAGACAAAGAGGAAGAAAAGGAGAAAGAAGAGAAGGAATCTGAGGATAAACCAGAGATAGAAGATGTTGGTTCTGATGAAGAGGA
AGAAGAAAAGAAGGATGGTGACAAGAAGAAGAAGAAGAAGATCAAGGAGAAGTATATTGATCAAGAGGAACTCAACAAGACAAAGCCTATTTGGACCAGA
AACCCCGATGACATCACTAATGAAGAGTACGGGGAGTTCTATAAGAGCTTGACCAATGACTGGGAGGATCACTTGGCTGTGCACTTTTCAGTCGAAGGGC
AGTTGGAGTTCAGAGCCCTTCTTTTCGTCCCAAGACGCGCTCCTTTCGACTTATTTGAAAACAGAAAGAAGAAGAACAACATCAAGCTGTATGTTCGCCG
AGTGTTCATCATGGACAACTGCGAGGAGCTCATCCCTGAGTATCTG---TTCATTAGAGGCGTGGTGGACTCTGAGGATCTCCCTCTGAACATTTCTCGT
GAGATGTTGCAACAAAGCAAAATTTTGAAAGTCATCAGGAAGAATCTGGTCAAGAAATGCTTAGAGCTCTTTACTGAATTGGCCGAAGATAAAGAGAATT
ACAAGAAGTTCTATGAGCAGTTCTCTAAAAATATTAAGCTTGGAATACATGAAGATTCTCAAAATCGGAAGAAGCTTTCCGAGCTGTTGAGGTACTACAC
TTCTGCTTCTGGCGACGAGATGGTTTCCCTCAAGGACTATTGCACCAGAATGAAGGAGAACCAGAAACACATCTATTACATCACA---GAGACCAAGGAC
CAGGTGGCCAACTCGGCCTTCGTGGAACGTCTGCGGAAGCACGGCCTGGAGGTGATCTACATGATCGAGCCCATCGATGAGTACTGTGTGCAGCAGCTGA
AGGAGTTTGAGGGGAAGACCTTAGTGTCAGTCACCAAAGAGGGCCTGGAGCTCCCGGAAGACGAAGAGGAGAAGAAGAAACAGGAGGAGAAGAAGACAAA
GTTTGAAAACCTCTGCAAGATCATGAAGGACATCTTGGAGAAGAAAGTGGAAAAGGTGGTTGTGTCGAACCGGTTGGTGACCTCACCATGCTGCATTGTC
ACAAGCACATACGGCTGGACAGCAAACATGGAGAGAATCATGAAGGCTCAAGCCCTGAGAGACAACTCGACAATGGGTTACATGGCAGCAAAGAAGCACC
TGGAGATAAATCCAGACCATTCCATCATCGAGACCCTGAGGCAAAAGGCAGAGGCGGACAAGAACGACAAGTCCGTGAAGGATCTGGTCATCCTGCTGTA
CGAAACCGCTCTGCTGTCTTCTGGCTTCAGCCTGGAAGATCCCCAGACGCACGCCAACAGGATCTACAGGATGATCAAACTTGGT---------------
---------------------------------------------------------------------------------------------------


>BGISUSP0000898375
MPEETQSQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTK
ADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDT-EPMGRGTKVILHLKEDQTEYLEE
RRIKEIVKKHSQFIGYPITL-VEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTR
NPDDITNEEYGEFYKSLTNDWEDHLAVHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNNIKLYVRRVFIMDNCEELIPEYL-FIRGVVDSEDLPLNISR
EMLQQSKILKVIRKNLVKKCLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKHIYYIT-ETKD
QVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIV
TSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLG-----
---------------------------------