Sequences
EST Library Info
nlu1Newborn 115 days, lung
Clusters
Oligos
SNPs

Gene ID ENSG00000186174 (click for geneview)
Transcript ID ENST00000334801(link to ensembl)
Symbol BCL9L
Localtion Chromosome:11:118272263:118286823:-1 band: 11q23.3
Description B-cell CLL/lymphoma 9-like
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<------------------------><-------------------------------------------------------------------------
-M--R--I--L--A--N--K--T--R--L--P--H--P--R--R--R--E--A--P--G--S--P--P--L--S--P--R--G--H--C--P--P--A--
ATGAGGATCCTGGCTAACAAGACAAGGTTACCCCACCCCAGGAGGAGAGAAGCTCCAGGGAGCCCGCCGCTGTCCCCCCGCGGTCATTGCCCCCCTGCCC
                           ::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::.:::::::::::::
---------------------------TTACCCCACCCCAGGAGGAGAGAAGCTCCAGGGAGCCCGCCGCTGTCCCCCCGCGGCCACTGCCCCCCTGCCC
----------------------------L--P--H--P--R--R--R--E--A--P--G--S--P--P--L--S--P--R--G--H--C--P--P--A--

----------------------------------------------------------------------------------------------------
P--A--K--P--M--H--P--E--N--K--L--T--N--H--G--K--T--G--N--G--G--A--Q--S--Q--H--Q--N--V--N--Q--G--P--T
CAGCCAAGCCAATGCACCCAGAAAATAAATTGACCAATCATGGCAAGACAGGGAATGGCGGGGCCCAATCTCAGCACCAGAATGTGAACCAAGGACCCAC
::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::
CAGCCAAGCCAATGCACCCAGAAAATAAGTTGACCAATCATGGCAAGACAGGGAATGGCGGGGCCCAATCCCAGCACCAGAATGTGAACCAAGGACCCAC
P--A--K--P--M--H--P--E--N--K--L--T--N--H--G--K--T--G--N--G--G--A--Q--S--Q--H--Q--N--V--N--Q--G--P--T

----------------------------------------------------------------------------------------------------
--C--N--V--G--S--K--G--V--G--A--G--N--H--G--A--K--A--N--Q--I--S--P--S--N--S--S--L--K--N--P--Q--A--G-
CTGCAACGTGGGCTCGAAGGGCGTGGGGGCGGGGAACCATGGGGCCAAGGCCAACCAGATCTCGCCTAGCAACTCAAGTCTGAAGAACCCCCAGGCAGGG
::::::: ::::::::::::::::::::: :.. ::::::    ::::  ::::::: :::::.::::.:::::::: ::: :: ::::::::. ::   
CTGCAACCTGGGCTCGAAGGGCGTGGGGGGGAATAACCATTNNNCCAACNCCAACCANATCTCACCTAACAACTCAATTCTNAANAACCCCCAANCATCC
--C--N--L--G--S--K--G--V--G--G--N--N--H--X--X--N--X--N--X--I--S--P--N--N--S--I--X--X--N--P--Q--X--S-

----------------------------------------------------------------------------------------------------
-V--P--P--F--S--S--L--K--G--K--V--K--R--D--R--S--V--S--V--D--S--G--E--Q--R--E--A--G--T--P--S--L--D--
GTGCCCCCTTTCAGCTCGCTCAAGGGCAAGGTGAAGAGGGACCGGAGTGTGTCTGTGGACTCTGGAGAGCAGCGAGAGGCTGGGACCCCATCCCTGGATT
 :      :::::::::::::                                                                               
TT-AAGGGTTTCAGCTCGCTC-------------------------------------------------------------------------------
-V--K--G--F--S--S--L--------------------------------------------------------------------------------

--------------><------------------------------------------------------------------------------------
S--E--A--K--E--V--A--P--R--S--K--R--R--C--V--L--E--R--K--Q--P--Y--S--G--D--E--W--C--S--G--P--D--S--E
CAGAGGCCAAAGAGGTGGCGCCGCGGAGTAAGCGGCGCTGTGTGCTGGAGCGGAAGCAGCCGTACAGTGGGGACGAATGGTGCTCTGGACCGGACAGTGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------><----------------------------------------------------------------
--E--D--D--K--P--I--G--A--T--H--N--C--N--V--A--D--P--A--M--A--A--P--Q--L--G--P--G--Q--T--T--Q--L--P-
GGAGGACGACAAGCCCATTGGGGCCACCCACAATTGTAATGTAGCAGACCCAGCCATGGCGGCCCCACAGCTGGGTCCCGGCCAAACCACCCAACTGCCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--S--E--S--S--V--P--G--A--P--H--G--P--P--P--G--L--R--P--D--A--P--G--G--G--G--G--G--G--G--V--P--G--
CTCAGCGAGAGCAGCGTGCCAGGCGCCCCGCACGGCCCTCCTCCTGGCCTTCGGCCTGATGCCCCTGGGGGCGGGGGCGGGGGCGGGGGCGTCCCCGGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------------><-----------------------------------------------
K--P--P--S--Q--F--V--Y--V--F--T--T--H--L--A--N--T--A--A--E--A--V--L--Q--G--R--A--D--S--I--L--A--Y--H
AGCCTCCCTCGCAGTTCGTATATGTCTTCACCACCCACCTGGCCAACACGGCTGCAGAGGCAGTGCTGCAGGGCCGGGCCGACTCCATCCTCGCCTACCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------><--------------------------------------------------------------
--Q--Q--N--V--P--R--A--K--L--D--Q--A--P--K--V--P--P--T--P--E--P--L--P--L--S--T--P--S--A--G--T--P--Q-
CCAGCAGAACGTGCCCCGGGCCAAGCTTGACCAGGCCCCTAAAGTGCCCCCCACCCCAGAACCGCTACCCCTGAGCACGCCGTCAGCAGGCACCCCGCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-S--Q--P--P--P--L--P--P--P--P--P--P--A--P--G--S--A--P--P--A--L--P--P--E--G--P--P--E--D--S--S--Q--D--
TCCCAGCCACCTCCACTGCCGCCGCCGCCACCCCCGGCCCCTGGCAGTGCCCCGCCTGCTCTGCCCCCAGAGGGGCCTCCTGAGGACAGCAGTCAGGACC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
L--A--P--N--S--V--G--A--A--S--T--G--G--G--T--G--G--T--H--P--N--T--P--T--A--T--T--A--N--N--P--L--P--P
TGGCCCCCAACTCGGTGGGAGCTGCCAGCACAGGTGGTGGGACTGGGGGCACCCACCCTAACACCCCGACGGCTACCACCGCCAACAACCCTCTGCCTCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--G--G--D--P--S--S--A--P--G--P--A--L--L--G--E--A--A--A--P--G--N--G--Q--R--S--L--V--G--S--E--G--L--S-
TGGAGGAGACCCCAGCAGTGCCCCCGGCCCTGCCCTGCTGGGGGAGGCAGCCGCCCCTGGAAATGGGCAGCGCAGCCTGGTGGGCTCAGAGGGCTTGTCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-K--E--Q--L--E--H--R--E--R--S--L--Q--T--L--R--D--I--E--R--L--L--L--R--S--G--E--T--E--P--F--L--K--G--
AAAGAGCAGCTGGAGCATCGGGAACGGTCCCTCCAGACGCTGCGAGACATTGAGCGACTGCTGCTCCGCAGCGGAGAGACTGAGCCCTTCCTCAAGGGGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
P--P--G--G--A--G--E--G--G--P--P--A--Q--A--P--P--P--P--Q--Q--P--P--T--A--P--P--S--G--L--K--K--Y--E--E
CCCCAGGAGGAGCGGGTGAGGGGGGCCCACCAGCACAAGCCCCCCCTCCCCCCCAGCAGCCACCCACGGCCCCTCCCAGCGGGCTGAAGAAATATGAGGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--P--L--Q--S--M--I--S--Q--T--Q--S--L--G--G--P--P--L--E--H--E--V--P--G--H--P--P--G--G--D--M--G--Q--Q-
ACCCTTGCAGTCCATGATTTCACAGACACAGAGCCTAGGGGGCCCCCCGCTGGAGCATGAAGTGCCTGGGCACCCCCCGGGTGGGGACATGGGGCAGCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-M--N--M--M--I--Q--R--L--G--Q--D--S--L--T--P--E--Q--V--A--W--R--K--L--Q--E--E--Y--Y--E--E--K--R--R--
ATGAACATGATGATACAGAGGCTGGGCCAGGACAGCCTCACGCCTGAGCAGGTGGCCTGGCGCAAGCTGCAGGAGGAGTACTACGAAGAGAAACGGCGGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
K--E--E--Q--I--G--L--H--G--S--R--P--L--Q--D--M--M--G--M--G--G--M--M--V--R--G--P--P--P--P--Y--H--S--K
AAGAGGAACAGATTGGGCTGCATGGGAGCCGTCCTCTGCAGGACATGATGGGCATGGGGGGCATGATGGTGAGGGGGCCCCCGCCTCCTTACCACAGCAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--P--G--D--Q--W--P--P--G--M--G--A--Q--L--R--G--P--M--D--V--Q--D--P--M--Q--L--R--G--G--P--P--F--P--G-
GCCTGGGGATCAGTGGCCACCTGGAATGGGTGCGCAGCTGCGGGGGCCCATGGATGTTCAAGATCCCATGCAGCTCCGGGGCGGACCTCCCTTTCCTGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-P--R--F--P--G--N--Q--I--Q--R--V--P--G--F--G--G--M--Q--S--M--P--M--E--V--P--M--N--A--M--Q--R--P--V--
CCCCGTTTCCCAGGCAACCAGATACAACGGGTACCTGGGTTTGGGGGCATGCAGAGTATGCCCATGGAGGTGCCCATGAATGCCATGCAGAGGCCCGTGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
R--P--G--M--G--W--T--E--D--L--P--P--M--G--G--P--S--N--F--A--Q--N--T--M--P--Y--P--G--G--Q--G--E--A--E
GACCAGGCATGGGCTGGACCGAAGACTTGCCCCCTATGGGGGGACCCAGCAATTTTGCCCAGAACACCATGCCCTACCCAGGTGGGCAGGGTGAGGCGGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--R--F--M--T--P--R--V--R--E--E--L--L--R--H--Q--L--L--E--K--R--S--M--G--M--Q--R--P--L--G--M--A--G--S-
GCGATTCATGACTCCCCGGGTCCGTGAGGAGCTGCTGCGGCACCAGCTGCTGGAGAAGCGGTCGATGGGCATGCAGCGCCCCCTGGGCATGGCAGGCAGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--M--G--Q--S--M--E--M--E--R--M--M--Q--A--H--R--Q--M--D--P--A--M--F--P--G--Q--M--A--G--G--E--G--L--
GGCATGGGACAGAGCATGGAGATGGAGCGGATGATGCAGGCGCACCGACAGATGGATCCTGCCATGTTTCCCGGGCAGATGGCTGGTGGTGAGGGCCTGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--G--T--P--M--G--M--E--F--G--G--G--R--G--L--L--S--P--P--M--G--Q--S--G--L--R--E--V--D--P--P--M--G--P
CGGGCACTCCCATGGGCATGGAGTTTGGTGGAGGCCGGGGCCTCCTGAGCCCTCCCATGGGGCAGTCTGGGCTGAGGGAGGTGGACCCACCCATGGGGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--G--N--L--N--M--N--M--N--V--N--M--N--M--N--M--N--L--N--V--Q--M--T--P--Q--Q--Q--M--L--M--S--Q--K--M-
AGGCAACCTCAACATGAACATGAATGTCAACATGAACATGAACATGAACCTGAACGTGCAGATGACCCCGCAGCAGCAGATGCTGATGTCGCAGAAGATG
                                              :::::::::::::::::::::::.::::::::::::::::::::::::::::::
----------------------------------------------AACCTGAACGTGCAGATGACCCCACAGCAGCAGATGCTGATGTCGCAGAAGATG
-----------------------------------------------N--L--N--V--Q--M--T--P--Q--Q--Q--M--L--M--S--Q--K--M-

----------------------------------------------------------------------------------------------------
-R--G--P--G--D--L--M--G--P--Q--G--L--S--P--E--E--M--A--R--V--R--A--Q--N--S--S--G--V--M--G--G--P--Q--
CGGGGCCCTGGGGACTTGATGGGGCCCCAGGGCCTCAGTCCTGAGGAGATGGCCCGGGTTCGGGCCCAGAACAGCAGTGGCGTGATGGGCGGCCCGCAGA
::::::::.:::::: :::::::::: :::::::::::::::::::::::::::::.:: :::::::::::::::::::::.::::::::::::::::::
CGGGGCCCCGGGGACATGATGGGGCCGCAGGGCCTCAGTCCTGAGGAGATGGCCCGAGTGCGGGCCCAGAACAGCAGTGGCATGATGGGCGGCCCGCAGA
-R--G--P--G--D--M--M--G--P--Q--G--L--S--P--E--E--M--A--R--V--R--A--Q--N--S--S--G--M--M--G--G--P--Q--

----------------------------------------------------------------------------------------------------
K--M--L--M--P--S--Q--F--P--N--Q--G--Q--Q--G--F--S--G--G--Q--G--P--Y--Q--A--M--S--Q--D--M--G--N--T--Q
AGATGCTGATGCCTTCACAGTTTCCCAACCAGGGCCAGCAGGGATTCTCTGGAGGCCAGGGACCCTACCAAGCCATGTCCCAGGACATGGGCAATACCCA
::::::: :::::.:::::::::::::::::::::::::::::::::::.::.::::::::::::::::::::::::.:::::::::::::::.:::.::
AGATGCTTATGCCCTCACAGTTTCCCAACCAGGGCCAGCAGGGATTCTCCGGGGGCCAGGGACCCTACCAAGCCATGCCCCAGGACATGGGCAGTACTCA
K--M--L--M--P--S--Q--F--P--N--Q--G--Q--Q--G--F--S--G--G--Q--G--P--Y--Q--A--M--P--Q--D--M--G--S--T--Q

----------------------------------------------------------------------------------------------------
--D--M--F--S--P--D--Q--S--S--M--P--M--S--N--V--G--T--T--R--L--S--H--M--P--L--P--P--A--S--N--P--P--G-
AGACATGTTCAGCCCTGATCAGAGCTCAATGCCCATGAGCAACGTGGGCACCACCCGGCTCAGCCACATGCCTCTGCCCCCTGCGTCCAATCCTCCTGGG
::::::::::::::: ::.:::::: :.:::::::::.::::.:::::.:::::::::::::::::::::::..::::::::::::::::::::::::::
AGACATGTTCAGCCCGGACCAGAGCACGATGCCCATGGGCAATGTGGGTACCACCCGGCTCAGCCACATGCCCTTGCCCCCTGCGTCCAATCCTCCTGGG
--D--M--F--S--P--D--Q--S--T--M--P--M--G--N--V--G--T--T--R--L--S--H--M--P--L--P--P--A--S--N--P--P--G-

----------------------------------------------------------------------------------------------------
-T--V--H--S--A--P--N--R--G--L--G--R--R--P--S--D--L--T--I--S--I--N--Q--M--G--S--P--G--M--G--H--L--K--
ACCGTGCATTCAGCCCCAAACCGGGGGCTAGGCAGGCGGCCTTCGGACCTCACCATCAGTATTAATCAGATGGGCTCACCGGGCATGGGGCACTTGAAGT
 :.::::::::::::::::::::::: ::.::::::::::::::.::::::::::::::::::::::::::::::::.::::::::::: :::.::::::
TCTGTGCATTCAGCCCCAAACCGGGGCCTGGGCAGGCGGCCTTCAGACCTCACCATCAGTATTAATCAGATGGGCTCGCCGGGCATGGGCCACCTGAAGT
-S--V--H--S--A--P--N--R--G--L--G--R--R--P--S--D--L--T--I--S--I--N--Q--M--G--S--P--G--M--G--H--L--K--

----------------------------------------------------------------------------------------------------
S--P--T--L--S--Q--V--H--S--P--L--V--T--S--P--S--A--N--L--K--S--P--Q--T--P--S--Q--M--V--P--L--P--S--A
CGCCCACCCTTAGCCAGGTGCACTCACCCCTGGTCACCTCGCCCTCTGCCAACCTCAAGTCACCCCAGACTCCCTCACAGATGGTGCCCTTGCCTTCTGC
:::::::::::::::::::.:::::::::::::::::::: :::::.::::::::::::::::::::::: :::::::::::::::::::::::::: ::
CGCCCACCCTTAGCCAGGTACACTCACCCCTGGTCACCTCTCCCTCCGCCAACCTCAAGTCACCCCAGACGCCCTCACAGATGGTGCCCTTGCCTTCGGC
S--P--T--L--S--Q--V--H--S--P--L--V--T--S--P--S--A--N--L--K--S--P--Q--T--P--S--Q--M--V--P--L--P--S--A

----------------------------------------------------------------------------------------------------
--N--P--P--G--P--L--K--S--P--Q--V--L--G--S--S--L--S--V--R--S--P--T--G--S--P--S--R--L--K--S--P--S--M-
CAACCCGCCAGGACCTCTCAAGTCGCCCCAGGTCCTCGGCTCCTCCCTCAGTGTCCGTTCACCCACTGGCTCGCCCAGCAGGCTCAAGTCTCCTTCCATG
::::::.::::::::::::::::::::::::::::::.:::::::::::::.::::::::.:::::.::::::::::::::::::::::::::.::::::
CAACCCACCAGGACCTCTCAAGTCGCCCCAGGTCCTCAGCTCCTCCCTCAGCGTCCGTTCGCCCACCGGCTCGCCCAGCAGGCTCAAGTCTCCCTCCATG
--N--P--P--G--P--L--K--S--P--Q--V--L--S--S--S--L--S--V--R--S--P--T--G--S--P--S--R--L--K--S--P--S--M-

----------------------------------------------------------------------------------------------------
-A--V--P--S--P--G--W--V--A--S--P--K--T--A--M--P--S--P--G--V--S--Q--N--K--Q--P--P--L--N--M--N--S--S--
GCGGTGCCTTCTCCAGGCTGGGTTGCCTCACCTAAGACGGCCATGCCCAGCCCGGGGGTCTCCCAGAACAAGCAGCCGCCTCTCAACATGAACTCTTCCA
::::::::::::::.::::::::.:::::.::.:::::.:::::::::::::: ::::::.:::::::::::::::::::::: ::::::::::::::::
GCGGTGCCTTCTCCGGGCTGGGTCGCCTCGCCCAAGACAGCCATGCCCAGCCCTGGGGTCCCCCAGAACAAGCAGCCGCCTCTGAACATGAACTCTTCCA
-A--V--P--S--P--G--W--V--A--S--P--K--T--A--M--P--S--P--G--V--P--Q--N--K--Q--P--P--L--N--M--N--S--S--

--------------------------><------------------------------------------------------------------------
T--T--L--S--N--M--E--Q--G--T--L--P--P--S--G--P--R--S--S--S--S--A--P--P--A--N--P--P--S--G--L--M--N--P
CCACCCTGAGCAACATGGAACAGGGTACCCTCCCGCCTAGCGGCCCCCGGAGCAGCTCCTCAGCACCTCCCGCCAACCCTCCCAGCGGCCTCATGAACCC
::::::::.::::::::::::::   .:::::::::::::::::::::::::::::::::::::.::::::.:::::::::::                 
CCACCCTGGGCAACATGGAACAG---GCCCTCCCGCCTAGCGGCCCCCGGAGCAGCTCCTCAGCGCCTCCCACCAACCCTCCC-----------------
T--T--L--G--N--M--E--Q-----A--L--P--P--S--G--P--R--S--S--S--S--A--P--P--T--N--P--P------------------

----------------------------------------------------------------------------------------------------
--S--L--P--F--T--S--S--P--D--P--T--P--S--Q--N--P--L--S--L--M--M--T--Q--M--S--K--Y--A--M--P--S--S--T-
CAGCCTACCATTCACTTCCTCCCCAGACCCCACACCTTCCCAGAACCCCCTGTCACTGATGATGACCCAGATGTCCAAGTACGCCATGCCCAGCTCCACC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-P--L--Y--H--N--A--I--K--T--I--A--T--S--D--D--E--L--L--P--D--R--P--L--L--P--P--P--P--P--P--Q--G--S--
CCGCTCTACCACAATGCCATCAAGACCATCGCCACCTCAGACGACGAGCTGCTGCCCGACCGGCCCCTGCTGCCCCCCCCACCACCACCGCAGGGCTCCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------><------------------------------------------------------------------------------------------
G--P--G--I--S--N--S--Q--P--S--Q--M--H--L--N--S--A--A--A--Q--S--P--M--G--M--N--L--P--G--Q--Q--P--L--S
GGCCAGGGATCAGCAACAGCCAGCCCAGCCAGATGCACCTGAACTCAGCCGCTGCCCAGAGCCCTATGGGCATGAACCTGCCAGGCCAGCAGCCCCTGTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--H--E--P--P--P--A--M--L--P--S--P--T--P--L--G--S--N--I--P--L--H--P--N--A--Q--G--T--G--G--P--P--Q--N-
CCATGAGCCCCCGCCCGCCATGCTGCCCTCCCCCACCCCTCTGGGCTCCAACATTCCACTGCATCCCAACGCACAGGGGACAGGGGGGCCCCCTCAAAAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-S--M--M--M--A--P--G--G--P--D--S--L--N--A--P--C--G--P--V--P--S--S--S--Q--M--M--P--F--P--P--R--L--Q--
TCCATGATGATGGCCCCAGGGGGCCCCGACTCCCTGAATGCCCCCTGTGGCCCAGTGCCCAGCTCCTCCCAGATGATGCCCTTCCCCCCTCGGCTGCAGC
                                                                                       :::::::::::::
---------------------------------------------------------------------------------------CCTCGGCTGCAGC
----------------------------------------------------------------------------------------P--R--L--Q--

----------------------------------------------------------------------------------------------------
Q--P--H--G--A--M--A--P--T--G--G--G--G--G--G--P--G--L--Q--Q--H--Y--P--S--G--M--A--L--P--P--E--D--L--P
AGCCCCATGGTGCCATGGCCCCCACTGGGGGTGGGGGCGGGGGGCCTGGCCTGCAGCAGCACTACCCGTCAGGCATGGCCCTGCCTCCCGAGGACCTGCC
:::::::.:::::::::::::::: ::::::.:::::::::::.::::::::::::::::::::::: :: :::::: :::::::.:: :::::::::::
AGCCCCACGGTGCCATGGCCCCCAGTGGGGGCGGGGGCGGGGGACCTGGCCTGCAGCAGCACTACCCTTCTGGCATGCCCCTGCCCCCAGAGGACCTGCC
Q--P--H--G--A--M--A--P--S--G--G--G--G--G--G--P--G--L--Q--Q--H--Y--P--S--G--M--P--L--P--P--E--D--L--P

----------------------------------------------------------------------------------------------------
--N--Q--P--P--G--P--M--P--P--Q--Q--H--L--M--G--K--A--M--A--G--R--M--G--D--A--Y--P--P--G--V--L--P--G-
CAACCAGCCGCCAGGCCCCATGCCTCCCCAGCAGCACCTGATGGGCAAAGCCATGGCTGGGCGCATGGGCGACGCATACCCACCGGGTGTGCTCCCTGGG
::.::::::.::::::::::::::.::::::::::::::::::::::::. ::::::.::::::::::::::::::::::: :::::.::::::::.:::
CAGCCAGCCACCAGGCCCCATGCCCCCCCAGCAGCACCTGATGGGCAAAAGCATGGCCGGGCGCATGGGCGACGCATACCCCCCGGGCGTGCTCCCCGGG
--S--Q--P--P--G--P--M--P--P--Q--Q--H--L--M--G--K--S--M--A--G--R--M--G--D--A--Y--P--P--G--V--L--P--G-

----------------------------------------------------------------------------------------------------
-V--A--S--V--L--N--D--P--E--L--S--E--V--I--R--P--T--P--T--G--I--P--E--F--D--L--S--R--I--I--P--S--E--
GTGGCATCAGTGCTGAACGACCCCGAGCTGAGCGAGGTGATCCGGCCCACCCCAACGGGGATCCCCGAGTTCGACTTGTCGAGGATCATCCCCTCTGAGA
::::::::::::::::::::::::::::::::.::::: ::::::::::::::.:::::::::::::::::::::::::: :::::::::::::: ::::
GTGGCATCAGTGCTGAACGACCCCGAGCTGAGTGAGGTCATCCGGCCCACCCCGACGGGGATCCCCGAGTTCGACTTGTCCAGGATCATCCCCTCGGAGA
-V--A--S--V--L--N--D--P--E--L--S--E--V--I--R--P--T--P--T--G--I--P--E--F--D--L--S--R--I--I--P--S--E--

----------------------------------------------------------------------------------------------------
K--P--S--S--T--L--Q--Y--F--P--K--S--E--N--Q--P--P--K--A--Q--P--P--N--L--H--L--M--N--L--Q--N--M--M--A
AGCCAAGCAGCACCCTCCAGTACTTCCCCAAGAGCGAGAACCAGCCCCCCAAGGCTCAGCCCCCTAATCTGCATCTCATGAACCTGCAGAACATGATGGC
:::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::.:::::::::::::::::::::::::::::::::::
AGCCAAGCAGCACCCTCCAGTACTTCCCCAAGAGCGAGAACCAGCCCCCCAAGGCCCAGCCCCCCAATCTGCATCTCATGAACCTGCAGAACATGATGGC
K--P--S--S--T--L--Q--Y--F--P--K--S--E--N--Q--P--P--K--A--Q--P--P--N--L--H--L--M--N--L--Q--N--M--M--A

----------------------------------------------------------------------------------------------------
--E--Q--T--P--S--R--P--P--N--L--P--G--Q--Q--G--V--Q--R--G--L--N--M--S--M--C--H--P--G--Q--M--S--L--L-
GGAGCAGACTCCCTCTCGGCCTCCCAACCTCCCAGGCCAGCAGGGCGTCCAGCGGGGGCTCAACATGTCCATGTGCCACCCTGGACAGATGTCCTTGCTG
:::::::::.:::::.:::::.:::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::
GGAGCAGACCCCCTCCCGGCCCCCCAACCTCCCGGGCCAGCAGGGCGTCCAGCGGGGGCTCAACATGTCCATGTGCCACCCCGGACAGATGTCCTTGCTG
--E--Q--T--P--S--R--P--P--N--L--P--G--Q--Q--G--V--Q--R--G--L--N--M--S--M--C--H--P--G--Q--M--S--L--L-

----------------------------------------------------------------------------------------------------
-G--R--T--G--V--P--P--Q--Q--G--M--V--P--H--G--L--H--Q--G--V--M--S--P--P--Q--G--L--M--T--Q--Q--N--F--
GGCAGGACAGGCGTGCCCCCACAGCAGGGGATGGTGCCCCATGGCCTGCACCAGGGGGTCATGTCCCCTCCACAAGGCCTCATGACCCAGCAGAATTTCA
:::::::::::.::::::::::::::::: :::::::::::.::::::::::::::::::::::::::::: ::::::::.:::::::::::::::::::
GGCAGGACAGGTGTGCCCCCACAGCAGGGCATGGTGCCCCACGGCCTGCACCAGGGGGTCATGTCCCCTCCTCAAGGCCTTATGACCCAGCAGAATTTCA
-G--R--T--G--V--P--P--Q--Q--G--M--V--P--H--G--L--H--Q--G--V--M--S--P--P--Q--G--L--M--T--Q--Q--N--F--

----------------------------------------------------------------------------------------------------
M--L--M--K--Q--R--G--V--G--G--E--V--Y--S--Q--P--P--H--M--L--S--P--Q--G--S--L--M--G--P--P--P--Q--Q--N
TGCTGATGAAGCAGCGGGGCGTGGGGGGCGAGGTCTACAGCCAGCCGCCCCACATGCTCTCCCCGCAGGGCTCCCTCATGGGCCCCCCGCCCCAGCAGAA
:::::::::::::::::::::::: .:: ::::::::::::::::: ::::::::::::::::: :::::::::::::::::::::::::::::::::::
TGCTGATGAAGCAGCGGGGCGTGGCAGGGGAGGTCTACAGCCAGCCCCCCCACATGCTCTCCCCCCAGGGCTCCCTCATGGGCCCCCCGCCCCAGCAGAA
M--L--M--K--Q--R--G--V--A--G--E--V--Y--S--Q--P--P--H--M--L--S--P--Q--G--S--L--M--G--P--P--P--Q--Q--N

----------------------------------------------------------------------------------------------------
--L--M--V--S--H--P--L--R--Q--R--S--V--S--L--D--S--Q--M--G--Y--L--P--A--P--G--G--M--A--N--L--P--F--*-
CCTCATGGTGTCCCACCCCCTTCGGCAGCGCAGTGTGTCCCTGGACAGCCAGATGGGCTACCTCCCGGCACCAGGCGGCATGGCCAACCTGCCCTTCTAG
::::::::::::::::::::: :::::::::::.:::::.:::::::::::::::::::::::::::::.::.:::::::::::::::::::::::::::
CCTCATGGTGTCCCACCCCCTGCGGCAGCGCAGCGTGTCTCTGGACAGCCAGATGGGCTACCTCCCGGCGCCGGGCGGCATGGCCAACCTGCCCTTCTAG
--L--M--V--S--H--P--L--R--Q--R--S--V--S--L--D--S--Q--M--G--Y--L--P--A--P--G--G--M--A--N--L--P--F--*-

Pig Consensus Sequence

>BGISUST0000900567
---------------------------TTACCCCACCCCAGGAGGAGAGAAGCTCCAGGGAGCCCGCCGCTGTCCCCCCGCGGCCACTGCCCCCCTGCCC
CAGCCAAGCCAATGCACCCAGAAAATAAGTTGACCAATCATGGCAAGACAGGGAATGGCGGGGCCCAATCCCAGCACCAGAATGTGAACCAAGGACCCAC
CTGCAACCTGGGCTCGAAGGGCGTGGGGGGGAATAACCATTNNNCCAACNCCAACCANATCTCACCTAACAACTCAATTCTNAANAACCCCCAANCATCc
aAGGGTTTCAGCTCGCTC----------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------AACCTGAACGTGCAGATGACCCCACAGCAGCAGATGCTGATGTCGCAGAAGATGCGG
GGCCCCGGGGACATGATGGGGCCGCAGGGCCTCAGTCCTGAGGAGATGGCCCGAGTGCGGGCCCAGAACAGCAGTGGCATGATGGGCGGCCCGCAGAAGA
TGCTTATGCCCTCACAGTTTCCCAACCAGGGCCAGCAGGGATTCTCCGGGGGCCAGGGACCCTACCAAGCCATGCCCCAGGACATGGGCAGTACTCAAGA
CATGTTCAGCCCGGACCAGAGCACGATGCCCATGGGCAATGTGGGTACCACCCGGCTCAGCCACATGCCCTTGCCCCCTGCGTCCAATCCTCCTGGGTCT
GTGCATTCAGCCCCAAACCGGGGCCTGGGCAGGCGGCCTTCAGACCTCACCATCAGTATTAATCAGATGGGCTCGCCGGGCATGGGCCACCTGAAGTCGC
CCACCCTTAGCCAGGTACACTCACCCCTGGTCACCTCTCCCTCCGCCAACCTCAAGTCACCCCAGACGCCCTCACAGATGGTGCCCTTGCCTTCGGCCAA
CCCACCAGGACCTCTCAAGTCGCCCCAGGTCCTCAGCTCCTCCCTCAGCGTCCGTTCGCCCACCGGCTCGCCCAGCAGGCTCAAGTCTCCCTCCATGGCG
GTGCCTTCTCCGGGCTGGGTCGCCTCGCCCAAGACAGCCATGCCCAGCCCTGGGGTCCCCCAGAACAAGCAGCCGCCTCTGAACATGAACTCTTCCACCA
CCCTGGGCAACATGGAACAG---GCCCTCCCGCCTAGCGGCCCCCGGAGCAGCTCCTCAGCGCCTCCCACCAACCCTCCC--------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------CCTCGGCTGCAGCAGC
CCCACGGTGCCATGGCCCCCAGTGGGGGCGGGGGCGGGGGACCTGGCCTGCAGCAGCACTACCCTTCTGGCATGCCCCTGCCCCCAGAGGACCTGCCCAG
CCAGCCACCAGGCCCCATGCCCCCCCAGCAGCACCTGATGGGCAAAAGCATGGCCGGGCGCATGGGCGACGCATACCCCCCGGGCGTGCTCCCCGGGGTG
GCATCAGTGCTGAACGACCCCGAGCTGAGTGAGGTCATCCGGCCCACCCCGACGGGGATCCCCGAGTTCGACTTGTCCAGGATCATCCCCTCGGAGAAGC
CAAGCAGCACCCTCCAGTACTTCCCCAAGAGCGAGAACCAGCCCCCCAAGGCCCAGCCCCCCAATCTGCATCTCATGAACCTGCAGAACATGATGGCGGA
GCAGACCCCCTCCCGGCCCCCCAACCTCCCGGGCCAGCAGGGCGTCCAGCGGGGGCTCAACATGTCCATGTGCCACCCCGGACAGATGTCCTTGCTGGGC
AGGACAGGTGTGCCCCCACAGCAGGGCATGGTGCCCCACGGCCTGCACCAGGGGGTCATGTCCCCTCCTCAAGGCCTTATGACCCAGCAGAATTTCATGC
TGATGAAGCAGCGGGGCGTGGCAGGGGAGGTCTACAGCCAGCCCCCCCACATGCTCTCCCCCCAGGGCTCCCTCATGGGCCCCCCGCCCCAGCAGAACCT
CATGGTGTCCCACCCCCTGCGGCAGCGCAGCGTGTCTCTGGACAGCCAGATGGGCTACCTCCCGGCGCCGGGCGGCATGGCCAACCTGCCCTTCTAG


>BGISUSP0000900567
---------LPHPRRREAPGSPPLSPRGHCPPAPAKPMHPENKLTNHGKTGNGGAQSQHQNVNQGPTCNLGSKGVGGNNH--N-N-ISPNNSI--NPQ-S
KGFSSL----------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------------------------------NLNVQMTPQQQMLMSQKMR
GPGDMMGPQGLSPEEMARVRAQNSSGMMGGPQKMLMPSQFPNQGQQGFSGGQGPYQAMPQDMGSTQDMFSPDQSTMPMGNVGTTRLSHMPLPPASNPPGS
VHSAPNRGLGRRPSDLTISINQMGSPGMGHLKSPTLSQVHSPLVTSPSANLKSPQTPSQMVPLPSANPPGPLKSPQVLSSSLSVRSPTGSPSRLKSPSMA
VPSPGWVASPKTAMPSPGVPQNKQPPLNMNSSTTLGNMEQ-ALPPSGPRSSSSAPPTNPP----------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------PRLQQPHGAMAPSGGGGGGPGLQQHYPSGMPLPPEDLPSQPPGPMPPQQHLMGKSMAGRMGDAYPPGVLPGV
ASVLNDPELSEVIRPTPTGIPEFDLSRIIPSEKPSSTLQYFPKSENQPPKAQPPNLHLMNLQNMMAEQTPSRPPNLPGQQGVQRGLNMSMCHPGQMSLLG
RTGVPPQQGMVPHGLHQGVMSPPQGLMTQQNFMLMKQRGVAGEVYSQPPHMLSPQGSLMGPPPQQNLMVSHPLRQRSVSLDSQMGYLPAPGGMANLPF*