Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000187105 (click for geneview)
Transcript ID ENST00000334988(link to ensembl)
Symbol NP_976054.1
Localtion Chromosome:14:73014949:73095404:-1 band: 14q24.3
Description hypothetical MGC48595
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--V--F--F--S--S--Q--Y--R--L--H--R--K--S--Q--Y--L--K--M--A--A--A--N--L--T--F--S--Q--E--V--V--W--Q--
ATGGTCTTCTTCAGCTCACAGTACCGTCTACACCGCAAGAGCCAATATTTGAAAATGGCTGCTGCAAACCTTACCTTCTCTCAGGAGGTGGTGTGGCAGC
         ::.:::.:::::.::.:: .::::: :::::.:::.::: :::::: .::::::::::::::.:::::.::::::::::::::::::: ::
---------TTTAGCCCACAGCACTGTGCACACCTCAAGAACCAGTATGTGAAAAAAGCTGCTGCAAACCTCACCTTTTCTCAGGAGGTGGTGTGGCTGC
----------F--S--P--Q--H--C--A--H--L--K--N--Q--Y--V--K--K--A--A--A--N--L--T--F--S--Q--E--V--V--W--L--

----------------------------------------------------------------------------------------------------
R--G--L--P--S--I--P--Y--S--Q--Y--S--F--D--H--L--Y--N--T--N--D--I--I--H--T--P--Q--I--R--K--A--R--P--Q
GAGGCCTGCCCAGCATTCCTTATAGCCAGTACAGCTTTGACCACCTCTACAATACCAATGACATCATCCATACTCCCCAGATCAGGAAGGCCCGGCCTCA
:::  :::::::::::::::::.::::::::::::::::::::.:::::::::.: .:..::::::::::  ::. : ::.:::::::::::::.::: :
GAGCGCTGCCCAGCATTCCTTACAGCCAGTACAGCTTTGACCATCTCTACAATGCAGACAACATCATCCAGCCTTGCAAGGTCAGGAAGGCCCGACCTGA
R--A--L--P--S--I--P--Y--S--Q--Y--S--F--D--H--L--Y--N--A--D--N--I--I--Q--P--C--K--V--R--K--A--R--P--E

----------------------------------------------------------------------------------------------------
--K--P--V--S--F--K--F--L--G--S--S--S--P--L--T--G--D--T--S--L--A--V--K--T--E--S--S--A--N--P--E--K--K-
GAAACCTGTTAGCTTCAAGTTCCTGGGTTCCTCAAGTCCCTTAACAGGAGACACCTCCCTGGCTGTGAAGACAGAAAGCTCTGCCAATCCCGAAAAGAAG
::::::::..:::.::::::::.:::.::..:::.::::::.::::...: :::::::: ::::.:::::::.:::::::::::::::     :::::::
GAAACCTGCCAGCCTCAAGTTCTTGGATTTTTCAGGTCCCTCAACAAAGGTCACCTCCCAGGCTATGAAGACGGAAAGCTCTGCCAAT---CTAAAGAAG
--K--P--A--S--L--K--F--L--D--F--S--G--P--S--T--K--V--T--S--Q--A--M--K--T--E--S--S--A--N-----L--K--K-

----------------------------------------------------------------------------------------------------
-L--K--K--S--K--P--A--S--T--V--R--E--A--P--R--P--L--I--H--H--P--C--M--H--P--D--M-----L--G--R--P--P--
CTGAAGAAATCAAAGCCAGCCAGCACCGTCCGGGAAGCACCCCGCCCTCTCATCCATCATCCCTGCATGCATCCAGATATG---CTGGGTCGGCCACCTT
::::::::::::::::::.: ::..: ::::.:::::::::. ::::::::::.: :::::::.::: : :.:::::.:::   :::   :  .: ::  
CTGAAGAAATCAAAGCCAACAAGTGCAGTCCAGGAAGCACCTGGCCCTCTCATTCTTCATCCCCGCAGGAACCCAGACATGGATCTGTCACTTTCTCCA-
-L--K--K--S--K--P--T--S--A--V--Q--E--A--P--G--P--L--I--L--H--P--R--R--N--P--D--M--D--L--S--L--S--P--

----------------------------------------------------------------------------------------------------
S--L--D--V--N--L--E--E--R--E--A--W--L--L--P--P--E--K--E--A--R--A--W--E--A--T--V--L--E--K--L--N--E--R
CTCTAGATGTGAACCTGGAGGAAAGAGAAGCCTGGCTTCTGCCTCCTGAGAAGGAGGCCAGAGCGTGGGAGGCCACTGTGCTGGAAAAGCTGAACGAGCG
     :::::::::::::::::.::.:::.:::::::::..::::::::.::.::::::::::: ::::::::.:..:::::::::::::: :::.::::
-----GATGTGAACCTGGAGGAGAGGGAAACCTGGCTTCCACCTCCTGAAAAAGAGGCCAGAGCCTGGGAGGCTATCGTGCTGGAAAAGCTTAACAAGCG
------D--V--N--L--E--E--R--E--T--W--L--P--P--P--E--K--E--A--R--A--W--E--A--I--V--L--E--K--L--N--K--R

----------------------------------------------------------------------------------------------------
--T--A--R--W--I--Q--S--K--R--P--R--R--P--G--A--S--P--N--K--W--Q--S--F--L--R--Q--Q--Y--D--W--S--H--I-
CACAGCCCGATGGATCCAGAGCAAGCGTCCTCGAAGGCCTGGGGCATCCCCCAACAAGTGGCAGAGCTTCCTGCGCCAGCAGTACGACTGGAGTCACATT
::: :::::::::::::::::::::::::::: .::::::::::..:.:::::..:::::::::::::::.:::::::::::::.::::::::.:::::.
CACTGCCCGATGGATCCAGAGCAAGCGTCCTCTGAGGCCTGGGGTGTTCCCCAGTAAGTGGCAGAGCTTCTTGCGCCAGCAGTATGACTGGAGCCACATC
--T--A--R--W--I--Q--S--K--R--P--L--R--P--G--V--F--P--S--K--W--Q--S--F--L--R--Q--Q--Y--D--W--S--H--I-

----------------------------------------------------------------------------------------------------
-R--D--E--L--T--S--A--S--D--L--E--L--L--K--Q--L--E--A--E--E--T--A--E--F--E--D--Q--S--V--I--L--P--P--
CGGGATGAGCTTACCTCTGCCAGTGACCTGGAGCTCCTGAAACAGCTGGAGGCAGAAGAGACAGCAGAGTTTGAGGATCAAAGTGTCATCCTGCCCCCAC
:::::::::::.::.::: ::::.::::::::::::.:.::::::::::::: :::::::...:::::.::::::::::.::: :::::::::.:: : :
CGGGATGAGCTCACTTCTTCCAGCGACCTGGAGCTCTTAAAACAGCTGGAGGAAGAAGAGGTGGCAGAATTTGAGGATCGAAGGGTCATCCTGTCCACTC
-R--D--E--L--T--S--S--S--D--L--E--L--L--K--Q--L--E--E--E--E--V--A--E--F--E--D--R--R--V--I--L--S--T--

------------------------------------------><--------------------------------------------------------
Q--E--K--K--K--P--E--L--L--L--P--V--Y--Y--R--L--P--S--Y--F--Q--Q--A--E--T--V--E--I--M--P--G--N--K--S
AGGAAAAGAAGAAGCCAGAACTGCTGCTTCCCGTTTACTACAGATTGCCCAGTTACTTCCAACAAGCAGAGACAGTTGAGATCATGCCTGGCAACAAGAG
::: ..:::::::::::::.:::::::::::.::.::.      :::::: .:::::: : :::::.. ::::::.:::.:.: :::::::.::::::: 
AGGTGGAGAAGAAGCCAGAGCTGCTGCTTCCTGTCTAT------TTGCCCCATTACTTGCCACAAGTGCAGACAGCTGAAACCCTGCCTGGTAACAAGAC
Q--V--E--K--K--P--E--L--L--L--P--V--Y--------L--P--H--Y--L--P--Q--V--Q--T--A--E--T--L--P--G--N--K--T

----------------------------------------------------------------------------------------------------
--T--E--D--I--H--E--K--T--S--L--S--Q--P--Q--T--Q--S--Y--F--R--Q--V--T--P--R--A--G--K--F--A--Y--S--T-
CACTGAGGATATCCATGAAAAGACGAGCCTCTCCCAGCCCCAAACCCAGAGCTACTTTCGCCAGGTGACTCCCCGAGCTGGAAAGTTTGCCTACTCCACA
..:::::: :::: ::::::: : :::: ::: :::::::: :: :::::::...: .:. ::::::: :::.:::::::::::::::::.:::::::::
TGCTGAGGCTATCGATGAAAACAGGAGCATCTACCAGCCCCCAAACCAGAGCCGTTGCCAACAGGTGAATCCTCGAGCTGGAAAGTTTGCTTACTCCACA
--A--E--A--I--D--E--N--R--S--I--Y--Q--P--P--N--Q--S--R--C--Q--Q--V--N--P--R--A--G--K--F--A--Y--S--T-

------------------------------><--------------------------------------------------------------------
-D--N--T--F--E--Q--E--I--Y--F--D--E--V--Q--I--I--H--Q--I--G--A--K--R--D--Q--I--V--L--E--N--L--N--R--
GACAACACCTTTGAACAGGAGATTTACTTTGATGAAGTCCAGATCATCCACCAGATTGGTGCAAAGAGAGACCAGATTGTCCTGGAAAACCTAAATCGGT
:::::::::::::::::::::::::::                                                                         
GACAACACCTTTGAACAGGAGATTTAC-------------------------------------------------------------------------
-D--N--T--F--E--Q--E--I--Y--------------------------------------------------------------------------

-----------------------------------------------------------------------><---------------------------
Y--N--K--Q--L--S--K--V--F--P--E--T--P--E--K--W--S--A--Q--A--I--P--E--A--S--Y--R--P--V--Q--G--A--L--R
ACAACAAGCAGCTATCTAAGGTCTTCCCTGAAACTCCAGAAAAGTGGAGTGCCCAGGCAATTCCTGAAGCATCTTACAGACCTGTGCAAGGAGCCCTGCG
                                                                             ::.:::::: :.:::::::::::
-----------------------------------------------------------------------------AGGCCTGTGAAGGGAGCCCTGCG
------------------------------------------------------------------------------R--P--V--K--G--A--L--R

----------------------------------------------------------------------------------------------------
--W--T--A--L--P--T--P--A--K--D--M--L--L--Q--V--G--E--K--D--V--P--I--K--T--R--R--L--K--K--Q--A--K--S-
CTGGACTGCTTTGCCCACCCCCGCCAAGGATATGCTGCTGCAGGTGGGTGAGAAGGATGTGCCTATTAAGACCAGGAGATTGAAGAAGCAGGCAAAATCA
:::::: :::.::::::: :: ::::::::: :::::::.:::::::::::::::::..::::.:: ::::::::::::.:::::               
CTGGACAGCTCTGCCCACACCAGCCAAGGATCTGCTGCTACAGGTGGGTGAGAAGGACATGCCCATGAAGACCAGGAGACTGAAG---------------
--W--T--A--L--P--T--P--A--K--D--L--L--L--Q--V--G--E--K--D--M--P--M--K--T--R--R--L--K----------------

---------------------------------------------------------------------------><-----------------------
-L--Q--E--D--V--T--W--E--L--V--V--L--R--R--M--L--K--E--W--K--T--A--W--A--L--I--I--E--W--H--H--E--T--
CTGCAGGAGGATGTGACCTGGGAACTGGTGGTCCTGCGGAGGATGCTGAAGGAATGGAAGACTGCCTGGGCTCTGATCATAGAGTGGCACCATGAGACAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
V--E--N--L--L--Q--S--L--G--D--L--H--D--D--V--R--I--K--A--I--T--T--C--A--T--A--A--L--E--R--P--R--I--A
TAGAGAACCTGCTTCAGAGCTTGGGAGACCTGCATGATGACGTTCGGATCAAAGCTATCACCACATGTGCCACAGCTGCTTTGGAACGGCCCCGGATTGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------><-------------------------------------------------------------------------------
--T--S--Q--R--D--S--D--K--T--I--Q--D--L--P--E--V--L--L--P--A--L--E--A--A--L--C--D--K--N--A--H--V--R-
CACCAGCCAGAGAGACTCAGACAAGACCATCCAGGACTTGCCGGAGGTTCTACTGCCTGCCCTAGAGGCTGCTCTTTGTGACAAGAATGCCCATGTGCGG
                            ::::::::::::::::::::::::: :::::::::..:::::::.:::::::::::::::::: .:::.:.:
----------------------------ATCCAGGACTTGCCGGAGGTTCTACAGCCTGCCCTGAAGGCTGCCCTTTGTGACAAGAATGCCAGTGTACAG
-----------------------------I--Q--D--L--P--E--V--L--Q--P--A--L--K--A--A--L--C--D--K--N--A--S--V--Q-

---------------------------------------------------------------------------------><-----------------
-M--A--A--A--I--C--Q--Y--A--I--Q--S--H--N--P--L--A--R--N--I--M--Q--T--A--L--L--K--G--N--S--V--D--S--
ATGGCAGCAGCAATATGCCAATATGCCATACAGTCACATAATCCCCTTGCCCGGAACATCATGCAGACTGCCCTTCTGAAGGGTAACAGTGTGGATAGCT
:::::::::::: :::::::.:::::.:::::::::::::::::.:::::::...::::: :::: .::::::::.:::::   ::.::.:..::.::::
ATGGCAGCAGCATTATGCCAGTATGCTATACAGTCACATAATCCTCTTGCCCAAGACATCTTGCACGCTGCCCTTTTGAAG---AATAGCGCAGACAGCT
-M--A--A--A--L--C--Q--Y--A--I--Q--S--H--N--P--L--A--Q--D--I--L--H--A--A--L--L--K-----N--S--A--D--S--

----------------------------------------------------------------------------------------------------
W--A--A--A--Q--C--L--A--L--E--G--T--A--T--Y--P--V--I--K--R--I--L--H--Q--L--F--T--K--K--N--E--D--T--E
GGGCTGCAGCTCAGTGCTTGGCTCTGGAAGGTACTGCTACTTACCCTGTGATTAAGAGGATCCTCCACCAGCTGTTTACAAAGAAGAATGAGGACACTGA
:::::::::::::::::::::::.::::::::.::::.::::::::.:::::::::::::::::::: :::::::::.  :::::::::::.::::: ::
GGGCTGCAGCTCAGTGCTTGGCTTTGGAAGGTGCTGCCACTTACCCCGTGATTAAGAGGATCCTCCAACAGCTGTTTGACAAGAAGAATGAAGACACGGA
W--A--A--A--Q--C--L--A--L--E--G--A--A--T--Y--P--V--I--K--R--I--L--Q--Q--L--F--D--K--K--N--E--D--T--E

------------------------------------------><--------------------------------------------------------
--E--Q--S--Y--I--L--L--S--Y--L--S--E--K--T--T--L--I--H--T--M--L--A--V--E--L--N--S--C--Q--W--K--N--R-
GGAACAGTCTTATATCCTCCTGAGCTATCTGAGTGAGAAGACAACCCTGATACACACCATGCTTGCTGTGGAGCTGAACAGCTGTCAATGGAAGAACCGG
: : :.:::::.::: :::::::::.:::: :::..:::::::::::::.:::::: :::::::::::::::::::::.:::..:::::::::..:::::
GCACCGGTCTTGTATGCTCCTGAGCCATCTCAGTAGGAAGACAACCCTGGTACACAGCATGCTTGCTGTGGAGCTGAATAGCCATCAATGGAAAGACCGG
--H--R--S--C--M--L--L--S--H--L--S--R--K--T--T--L--V--H--S--M--L--A--V--E--L--N--S--H--Q--W--K--D--R-

-----------------------------------------------><---------------------------------------------------
-I--V--A--C--Q--A--F--S--R--I--S--G--N--V--C--L--D--M--K--H--K--L--I--Q--L--M--W--N--D--W--N--K--E--
ATTGTGGCCTGCCAGGCTTTCTCCCGGATCAGTGGAAATGTCTGCTTGGATATGAAACATAAGTTGATCCAGCTGATGTGGAATGACTGGAATAAGGAAG
:::::::::::::.::::.::::::.:::..::::: ::::: :.::::::::::.::::::::::::::::::::::: ::.:::::::::::::.:::
ATTGTGGCCTGCCGGGCTCTCTCCCAGATTGGTGGACATGTCAGTTTGGATATGAGACATAAGTTGATCCAGCTGATGTTGAGTGACTGGAATAAGAAAG
-I--V--A--C--R--A--L--S--Q--I--G--G--H--V--S--L--D--M--R--H--K--L--I--Q--L--M--L--S--D--W--N--K--K--

------------------------------------------------------------------><--------------------------------
V--R--R--A--A--A--Q--A--L--G--Q--M--S--L--G--K--E--V--H--D--I--I--R--V--K--L--G--Q--G--N--S--Q--E--R
TGAGGAGAGCAGCTGCACAGGCGCTTGGGCAAATGAGCCTCGGGAAAGAGGTGCACGACATAATCAGGGTCAAGCTAGGTCAAGGAAATTCCCAGGAGCG
::::. .::::::::: ::.:: :: :::::.::::.:::.:::::.::::::::.:::         :::::.::.:::::::::::::::::::::::
TGAGACAAGCAGCTGCCCAAGCTCTGGGGCAGATGAACCTTGGGAAGGAGGTGCATGAC---------GTCAAACTGGGTCAAGGAAATTCCCAGGAGCG
V--R--Q--A--A--A--Q--A--L--G--Q--M--N--L--G--K--E--V--H--D-----------V--K--L--G--Q--G--N--S--Q--E--R

----------------------------------------------------------------------------------------------------
--V--E--A--L--Y--L--I--G--E--L--K--L--M--T--A--K--L--L--P--S--F--L--H--C--F--S--D--D--F--T--A--V--R-
TGTGGAAGCTCTCTACCTGATAGGTGAGCTCAAGCTTATGACCGCCAAGCTTCTCCCAAGCTTCCTGCACTGCTTCTCTGATGACTTCACAGCAGTTCGG
:::::::::.:::  ::::::  :::::::::::::.:::::.::::::::::::::::::::.::: :::::::::::::::::::::..:::::::::
TGTGGAAGCCCTCATCCTGATTCGTGAGCTCAAGCTCATGACTGCCAAGCTTCTCCCAAGCTTTCTGAACTGCTTCTCTGATGACTTCATGGCAGTTCGG
--V--E--A--L--I--L--I--R--E--L--K--L--M--T--A--K--L--L--P--S--F--L--N--C--F--S--D--D--F--M--A--V--R-

-----------------------------------------------><---------------------------------------------------
-R--A--A--C--L--A--A--G--A--L--Q--I--R--D--K--M--V--L--E--C--L--L--N--L--M--Q--R--D--P--Y--W--K--I--
CGGGCAGCCTGTTTGGCAGCTGGTGCCCTGCAGATCCGCGACAAGATGGTGCTTGAATGCCTCCTGAACCTGATGCAGAGAGATCCTTACTGGAAAATCA
::::::::.::::::::::::::::::.:::::::.::.::..::::::: :::::::::::.:::::.:::::.:::::::::::.: :::::::::::
CGGGCAGCTTGTTTGGCAGCTGGTGCCTTGCAGATTCGTGATGAGATGGTCCTTGAATGCCTTCTGAATCTGATACAGAGAGATCCCTTCTGGAAAATCA
-R--A--A--C--L--A--A--G--A--L--Q--I--R--D--E--M--V--L--E--C--L--L--N--L--I--Q--R--D--P--F--W--K--I--

-----------------><---------------------------------------------------------------------------------
K--A--F--A--I--R--A--L--G--Q--I--G--Q--V--S--P--E--L--T--D--L--L--L--W--A--I--H--Y--E--E--S--P--G--V
AGGCCTTTGCCATTCGAGCTTTGGGACAGATTGGGCAAGTAAGTCCCGAGCTGACGGATCTTCTGCTCTGGGCTATCCACTATGAAGAGTCACCAGGTGT
:::::::::::::.:::                                                                     .:.:::::::::::
AGGCCTTTGCCATCCGA---------------------------------------------------------------------AAATCACCAGGTGT
K--A--F--A--I--R-----------------------------------------------------------------------K--S--P--G--V

----------------------------------------------------------------------------------------------------
--R--L--E--A--C--R--S--I--L--A--L--K--L--Q--G--D--R--V--R--D--T--F--L--D--V--L--L--L--E--N--H--D--A-
ACGGCTGGAAGCTTGCCGTAGCATCCTAGCCCTGAAACTTCAAGGGGACCGGGTCAGGGACACCTTCCTAGACGTGCTGCTCCTGGAGAACCACGATGCT
:::.::.::.::::::::::::::::::::::: :::::::::::.::::: ::::::::::::::::::::.:::::::::::.::::::::.::::::
ACGACTAGAGGCTTGCCGTAGCATCCTAGCCCTCAAACTTCAAGGAGACCGTGTCAGGGACACCTTCCTAGATGTGCTGCTCCTAGAGAACCATGATGCT
--R--L--E--A--C--R--S--I--L--A--L--K--L--Q--G--D--R--V--R--D--T--F--L--D--V--L--L--L--E--N--H--D--A-

-------><-----------------------------------------------------------------------------><------------
-V--L--K--E--M--Y--Q--T--M--K--I--L--N--L--G--N--E--G--N--Q--E--M--L--Q--E--I--K--N--R--I--K--T--L--
GTTCTAAAAGAAATGTACCAGACAATGAAGATACTCAACTTAGGAAATGAAGGAAACCAAGAAATGCTTCAGGAGATCAAGAACAGGATTAAAACACTAA
::::::   ::::: .:::: .::::::::: :::::::::::.:::::::::::::::::::::::::::::::::::::::::::             
GTTCTA---GAAATTCACCATGCAATGAAGAAACTCAACTTAGAAAATGAAGGAAACCAAGAAATGCTTCAGGAGATCAAGAACAGG-------------
-V--L-----E--I--H--H--A--M--K--K--L--N--L--E--N--E--G--N--Q--E--M--L--Q--E--I--K--N--R--------------

----------------------------------------------------------------------------------------------------
S--Q--K--D--L--L--T--H--K--I--L--K--L--E--M--V--M--G--K--V--R--E--E--A--K--R--V--Y--L--K--P--K--G--E
GCCAAAAGGACTTGCTGACACACAAAATACTCAAGCTGGAGATGGTCATGGGAAAAGTGAGGGAGGAAGCAAAACGTGTTTACTTGAAACCCAAAGGAGA
                                                              ::::::::::::::::::::.::: :::::::::.::.
--------------------------------------------------------------GAGGAAGCAAAACGTGTTTATTTGCAACCCAAAGAAGG
---------------------------------------------------------------E--E--A--K--R--V--Y--L--Q--P--K--E--G

----------------------------------------------><----------------------------------------------------
--Q--G--P--L--T--L--Q--T--L--L--Q--E--T--F--Q--D--E--M--V--L--P--R--R--P--S--E--V--C--D--T--E--A--V-
ACAAGGACCACTAACACTCCAGACTTTACTCCAAGAAACTTTTCAGGATGAGATGGTTCTTCCTAGAAGACCTTCCGAGGTTTGTGACACTGAAGCAGTG
.:::..::::::..  :: :: ::::: :::::::::::::::                                                         
GCAAAAACCACTGGACCTACATACTTTTCTCCAAGAAACTTTT---------------------------------------------------------
--Q--K--P--L--D--L--H--T--F--L--Q--E--T--F----------------------------------------------------------

-----><---------------------------------------------------------------------------------------------
-I--K--P--V--K--P--R--A--P--N--P--W--L--Q--S--S--V--P--G--L--T--T--R--S--K--V--R--S--S--L--V--K--D--
ATAAAGCCTGTGAAGCCCCGCGCACCAAATCCCTGGTTACAAAGTTCAGTCCCAGGCCTAACCACACGAAGCAAAGTTCGTTCATCACTTGTCAAAGATC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
L--R--T--S--P--E--K--R--I--A--V--G--P--F--R--S--D--Y--P--A--L--Y--L--G--K--F--S--E--R--T--F--F--S--P
TACGCACCTCCCCCGAGAAAAGGATTGCTGTGGGACCATTTAGATCCGACTACCCAGCTCTTTATCTGGGTAAATTCTCAGAGAGAACATTTTTTTCTCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------>
--I--M--S--S--P--S--G--K--K--G--A--H--L--*-
CATCATGTCTTCTCCCTCTGGAAAGAAAGGTGCTCATCTCTAA
                                           
-------------------------------------------
-------------------------------------------

Pig Consensus Sequence

>BGISUST0000886384
---------TTTAGCCCACAGCACTGTGCACACCTCAAGAACCAGTATGTGAAAAAAGCTGCTGCAAACCTCACCTTTTCTCAGGAGGTGGTGTGGCTGC
GAGCGCTGCCCAGCATTCCTTACAGCCAGTACAGCTTTGACCATCTCTACAATGCAGACAACATCATCCAGCCTTGCAAGGTCAGGAAGGCCCGACCTGA
GAAACCTGCCAGCCTCAAGTTCTTGGATTTTTCAGGTCCCTCAACAAAGGTCACCTCCCAGGCTATGAAGACGGAAAGCTCTGCCAATCTAAAGAAGCTG
AAGAAATCAAAGCCAACAAGTGCAGTCCAGGAAGCACCTGGCCCTCTCATTCTTCATCCCCGCAGGAACCCAGACATGGATCTGTCACTTTCTCCAGATG
TGAACCTGGAGGAGAGGGAAACCTGGCTTCCACCTCCTGAAAAAGAGGCCAGAGCCTGGGAGGCTATCGTGCTGGAAAAGCTTAACAAGCGCACTGCCCG
ATGGATCCAGAGCAAGCGTCCTCTGAGGCCTGGGGTGTTCCCCAGTAAGTGGCAGAGCTTCTTGCGCCAGCAGTATGACTGGAGCCACATCCGGGATGAG
CTCACTTCTTCCAGCGACCTGGAGCTCTTAAAACAGCTGGAGGAAGAAGAGGTGGCAGAATTTGAGGATCGAAGGGTCATCCTGTCCACTCAGGTGGAGA
AGAAGCCAGAGCTGCTGCTTCCTGTC------TTGCCCCATTACTTGCCACAAGTGCAGACAGCTGAAACCCTGCCTGGTAACAAGACTGCTGAGGCTAT
CGATGAAAACAGGAGCATCTACCAGCCCCCAAACCAGAGCCGTTGCCAACAGGTGAATCCTCGAGCTGGAAAGTTTGCTTACTCCACAGACAACACCTTT
GAACAGGAGATTTAC-------------------------------------------------------------------------------------
-----------------------------------------------------------------AGGCCTGTGAAGGGAGCCCTGCGCTGGACAGCTCT
GCCCACACCAGCCAAGGATCTGCTGCTACAGGTGGGTGAGAAGGACATGCCCATGAAGACCAGGAGACTGAAG---------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------ATCCAGGACTTGCCGGAGGTTCTACAGCCTGCCCTGAAGGCTGCCCTTTGTGACAAGAATGCCAGTGTACAGATGGCAGCAGCA
TTATGCCAGTATGCTATACAGTCACATAATCCTCTTGCCCAAGACATCTTGCACGCTGCCCTTTTGAAG---AATAGCGCAGACAGCTGGGCTGCAGCTC
AGTGCTTGGCTTTGGAAGGTGCTGCCACTTACCCCGTGATTAAGAGGATCCTCCAACAGCTGTTTGACAAGAAGAATGAAGACACGGAGCACCGGTCTTG
TATGCTCCTGAGCCATCTCAGTAGGAAGACAACCCTGGTACACAGCATGCTTGCTGTGGAGCTGAATAGCCATCAATGGAAAGACCGGATTGTGGCCTGC
CGGGCTCTCTCCCAGATTGGTGGACATGTCAGTTTGGATATGAGACATAAGTTGATCCAGCTGATGTTGAGTGACTGGAATAAGAAAGTGAGACAAGCAG
CTGCCCAAGCTCTGGGGCAGATGAACCTTGGGAAGGAGGTGCATGAC---------GTCAAACTGGGTCAAGGAAATTCCCAGGAGCGTGTGGAAGCCCT
CATCCTGATTCGTGAGCTCAAGCTCATGACTGCCAAGCTTCTCCCAAGCTTTCTGAACTGCTTCTCTGATGACTTCATGGCAGTTCGGCGGGCAGCTTGT
TTGGCAGCTGGTGCCTTGCAGATTCGTGATGAGATGGTCCTTGAATGCCTTCTGAATCTGATACAGAGAGATCCCTTCTGGAAAATCAAGGCCTTTGCCA
TCCGA---------------------------------------------------------------------AAATCACCAGGTGTACGACTAGAGGC
TTGCCGTAGCATCCTAGCCCTCAAACTTCAAGGAGACCGTGTCAGGGACACCTTCCTAGATGTGCTGCTCCTAGAGAACCATGATGCTGTTCTA---GAA
ATTCACCATGCAATGAAGAAACTCAACTTAGAAAATGAAGGAAACCAAGAAATGCTTCAGGAGATCAAGAACAGG-------------------------
--------------------------------------------------GAGGAAGCAAAACGTGTTTATTTGCAACCCAAAGAAGGGCAAAAACCACT
GGACCTACATACTTTTCTCCAAGAAACTTTT---------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------


>BGISUSP0000886384
---FSPQHCAHLKNQYVKKAAANLTFSQEVVWLRALPSIPYSQYSFDHLYNADNIIQPCKVRKARPEKPASLKFLDFSGPSTKVTSQAMKTESSANLKKL
KKSKPTSAVQEAPGPLILHPRRNPDMDLSLSPDVNLEERETWLPPPEKEARAWEAIVLEKLNKRTARWIQSKRPLRPGVFPSKWQSFLRQQYDWSHIRDE
LTSSSDLELLKQLEEEEVAEFEDRRVILSTQVEKKPELLLPV--LPHYLPQVQTAETLPGNKTAEAIDENRSIYQPPNQSRCQQVNPRAGKFAYSTDNTF
EQEIY--------------------------------------------------RPVKGALRWTALPTPAKDLLLQVGEKDMPMKTRRLK---------
------------------------------------------------------------------------IQDLPEVLQPALKAALCDKNASVQMAAA
LCQYAIQSHNPLAQDILHAALLK-NSADSWAAAQCLALEGAATYPVIKRILQQLFDKKNEDTEHRSCMLLSHLSRKTTLVHSMLAVELNSHQWKDRIVAC
RALSQIGGHVSLDMRHKLIQLMLSDWNKKVRQAAAQALGQMNLGKEVHD---VKLGQGNSQERVEALILIRELKLMTAKLLPSFLNCFSDDFMAVRRAAC
LAAGALQIRDEMVLECLLNLIQRDPFWKIKAFAIR-----------------------KSPGVRLEACRSILALKLQGDRVRDTFLDVLLLENHDAVL-E
IHHAMKKLNLENEGNQEMLQEIKNR-------------------------EEAKRVYLQPKEGQKPLDLHTFLQETF-----------------------
-----------------------------------------------------------------------------