Sequences
EST Library Info
ecc1Foetus 50 days, cortex cerebri
elu1Foetus 50 days, lung
ese2Foetus 50 days, M. semitendinosus
relu1Unavailable
sme1M. Semimembranosus
spl1Spleen
Clusters
Oligos
SNPs

Gene ID ENSG00000140153 (click for geneview)
Transcript ID ENST00000335263(link to ensembl)
Symbol NP_851808.1
Localtion Chromosome:14:101675965:101759757:1 band: 14q32.32
Description WD repeat domain 20 isoform 1
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--T--E--G--G--G--K--E--M--N--E--I--K--T--Q--F--T--T--R--E--G--L--Y--K--L--L--P--H--S--E--Y--S--
ATGGCGACGGAGGGAGGAGGGAAGGAGATGAACGAGATTAAGACCCAATTCACCACCCGGGAAGGTCTGTACAAGCTGCTGCCGCACTCGGAGTACAGCC
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
ATGGCGACGGAGGGAGGAGGGAAGGAGATGAACGAGATTAAGACCCAATTCACCACCCGGGAAGGTCTGTACAAGCTGCTGCCGCACTCGGAGTACAGCC
-M--A--T--E--G--G--G--K--E--M--N--E--I--K--T--Q--F--T--T--R--E--G--L--Y--K--L--L--P--H--S--E--Y--S--

----------------------------------------------------------------------------------------------------
R--P--N--R--V--P--F--N--S--Q--G--S--N--P--V--R--V--S--F--V--N--L--N--D--Q--S--G--N--G--D--R--L--C--F
GGCCCAACCGGGTGCCCTTCAACTCGCAGGGATCCAACCCTGTCCGCGTCTCCTTCGTAAACCTCAACGACCAGTCTGGCAACGGCGACCGCCTCTGCTT
:::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GGCCCAACCGGGTGCCCTTCAGCTCGCAGGGATCCAACCCTGTCCGCGTCTCCTTCGTAAACCTCAACGACCAGTCTGGCAACGGCGACCGCCTCTGCTT
R--P--N--R--V--P--F--S--S--Q--G--S--N--P--V--R--V--S--F--V--N--L--N--D--Q--S--G--N--G--D--R--L--C--F

------------------------------------------------><--------------------------------------------------
--N--V--G--R--E--L--Y--F--Y--I--Y--K--G--V--R--K--A--A--D--L--S--K--P--I--D--K--R--I--Y--K--G--T--Q-
CAATGTGGGCCGGGAGCTGTACTTCTATATCTACAAGGGGGTCCGCAAGGCTGCTGACTTGAGTAAACCAATAGATAAAAGGATATACAAAGGAACACAG
:::::::::::::::::: :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CAATGTGGGCCGGGAGCTCTACTTCTATATCTACAAGGGGGTCCGCAAGGCTGCTGACTTGAGTAAACCAATAGATAAAAGGATATACAAAGGAACACAG
--N--V--G--R--E--L--Y--F--Y--I--Y--K--G--V--R--K--A--A--D--L--S--K--P--I--D--K--R--I--Y--K--G--T--Q-

----------------------------------------------------------------------------------------------------
-P--T--C--H--D--F--N--H--L--T--A--T--A--E--S--V--S--L--L--V--G--F--S--A--G--Q--V--Q--L--I--D--P--I--
CCTACTTGTCATGACTTCAACCACCTAACAGCCACAGCAGAAAGTGTCTCTCTCCTAGTGGGCTTTTCCGCAGGCCAAGTCCAGCTTATAGACCCAATCA
:::::::::::::::::::::::::: :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCTACTTGTCATGACTTCAACCACCTCACAGCCACAGCAGAAAGTGTCTCTCTCCTAGTGGGCTTTTCCGCAGGCCAAGTCCAGCTTATAGACCCAATCA
-P--T--C--H--D--F--N--H--L--T--A--T--A--E--S--V--S--L--L--V--G--F--S--A--G--Q--V--Q--L--I--D--P--I--

----------------------------------><----------------------------------------------------------------
K--K-----E--T--S--K--L--F--N--E--E--R--L--I--D--K--S--R--V--T--C--V--K--W--V--P--G--S--E--S--L--F--L
AAAAA---GAAACTAGCAAACTTTTTAATGAGGAAAGACTAATAGACAAGTCACGAGTTACCTGTGTCAAATGGGTTCCCGGTTCGGAAAGCCTTTTCCT
:.:::   :::::::::::::: :::::::::::::::::::::::::::::.::::: ::::::::::.:::::::::.:::::::::::::: :::::
AGAAAA--GAAACTAGCAAACTATTTAATGAGGAAAGACTAATAGACAAGTCGCGAGTAACCTGTGTCAGATGGGTTCCTGGTTCGGAAAGCCTGTTCCT
K--K--\--E--T--S--K--L--F--N--E--E--R--L--I--D--K--S--R--V--T--C--V--R--W--V--P--G--S--E--S--L--F--L

----------------------------------------------------------------------------------------------------
--V--A--H--S--S--G--N--M--Y--L--Y--N--V--E--H--T--C--G--T--T--A--P--H--Y--Q--L--L--K--Q--G--E--S--F-
AGTAGCCCACTCGAGTGGGAACATGTACTTATATAATGTGGAGCACACTTGTGGCACCACAGCCCCCCACTACCAGCTTCTGAAGCAGGGAGAGAGCTTT
:::::::::.:::::.::::::::::::::.:::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::: 
AGTAGCCCATTCGAGCGGGAACATGTACTTGTATAATGTGGAGCACGCTTGTGGCACCACAGCCCCCCACTACCAGCTTCTGAAGCAGGGAGAGAGCTTG
--V--A--H--S--S--G--N--M--Y--L--Y--N--V--E--H--A--C--G--T--T--A--P--H--Y--Q--L--L--K--Q--G--E--S--L-

----------------------------------------------------------------------------------------------------
-A--V--H--T--C--K--S--K--S--T--R--N--P--L--L--K--W--T--V--G--E--G--A--L--N--E--F--A--F--S--P--D--G--
GCCGTGCACACTTGCAAGAGCAAATCCACGAGGAACCCTCTCCTTAAGTGGACGGTGGGCGAGGGGGCCCTCAACGAGTTTGCTTTCTCCCCAGATGGCA
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GCCGTGCACACTTGCAAGAGCAAATCCACGAGGAACCCTCTCCTTAAGTGGACGGTGGGCGAGGGGGCCCTCAACGAGTTTGCTTTCTCCCCAGATGGCA
-A--V--H--T--C--K--S--K--S--T--R--N--P--L--L--K--W--T--V--G--E--G--A--L--N--E--F--A--F--S--P--D--G--

----------------------------------------------------------------------------------------------------
K--F--L--A--C--V--S--Q--D--G--F--L--R--V--F--N--F--D--S--V--E--L--H--G--T--M--K--S--Y--F--G--G--L--L
AGTTCTTAGCGTGCGTGAGCCAGGACGGGTTTCTGCGGGTGTTCAACTTTGACTCAGTGGAGCTGCACGGTACGATGAAAAGCTACTTTGGGGGCTTGCT
:::::::.:::::::::::::::::::: ::.:::::::::::::::::::::::.::::::::::::::.:: :::::::::::::::::.::::::::
AGTTCTTGGCGTGCGTGAGCCAGGACGGCTTCCTGCGGGTGTTCAACTTTGACTCGGTGGAGCTGCACGGCACCATGAAAAGCTACTTTGGAGGCTTGCT
K--F--L--A--C--V--S--Q--D--G--F--L--R--V--F--N--F--D--S--V--E--L--H--G--T--M--K--S--Y--F--G--G--L--L

----------------------------------------------------------------------------------------------------
--C--V--C--W--S--P--D--G--K--Y--I--V--T--G--G--E--D--D--L--V--T--V--W--S--F--V--D--C--R--V--I--A--R-
GTGTGTGTGCTGGAGCCCGGATGGCAAGTACATCGTGACAGGTGGGGAGGACGACTTGGTGACAGTCTGGTCCTTTGTAGACTGCCGAGTAATAGCCAGA
:::.:::::::::::::: ::.:::::::::::.:::::.::.:: :::::::::.:::::::.::::::::.:::: ::::.::::.::.:::::  :.
GTGCGTGTGCTGGAGCCCCGACGGCAAGTACATTGTGACGGGCGGCGAGGACGACCTGGTGACGGTCTGGTCTTTTGGAGACCGCCGGGTGATAGCGCGG
--C--V--C--W--S--P--D--G--K--Y--I--V--T--G--G--E--D--D--L--V--T--V--W--S--F--G--D--R--R--V--I--A--R-

----------------------------------------------------------------------------------------------------
-G--H--G--H--K--S--W--V--S--V--V--A--F--D--P--Y--T--T--S--V--E--E--G--D--P--M--E--F--S--G--S--D--E--
GGCCACGGGCACAAGTCCTGGGTCAGTGTTGTAGCGTTTGACCCTTATACCACTAGTGTAGAAGAAGGTGACCCTATGGAGTTTAGTGGCAGCGATGAGG
::::::::::::::::::::::::::.:: ::.:: ::.:::::.::.:::::.::.::.::.::..:.:::::: :::::.: :::::::::::.::::
GGCCACGGGCACAAGTCCTGGGTCAGCGTGGTGGCCTTCGACCCCTACACCACCAGCGTGGAGGAGAGCGACCCTCTGGAGCTGAGTGGCAGCGACGAGG
-G--H--G--H--K--S--W--V--S--V--V--A--F--D--P--Y--T--T--S--V--E--E--S--D--P--L--E--L--S--G--S--D--E--

----------------------------------------------------------------------------------------------------
D--F--Q--D--L--L--H--F--G--R--D--R--A--N--S--T--Q--S--R--L--S--K--R--N--S--T--D--S--R--P--V--S--V--T
ACTTCCAAGACCTTCTTCATTTTGGCAGAGATCGAGCAAATAGTACACAGTCCAGGCTCTCCAAACGGAACTCTACAGACAGCCGCCCCGTAAGTGTCAC
:::::::::::::::: ::.::.::: ::::.:: :: ::.::.:: :::::: :::: :::::.:::::::: :: :: ::::::::::: ::.:::::
ACTTCCAAGACCTTCTGCACTTCGGCCGAGACCGCGCCAACAGCACCCAGTCCCGGCTGTCCAAGCGGAACTCGACCGAGAGCCGCCCCGTCAGCGTCAC
D--F--Q--D--L--L--H--F--G--R--D--R--A--N--S--T--Q--S--R--L--S--K--R--N--S--T--E--S--R--P--V--S--V--T

----------------------------------------------------------------------------------------------------
--Y--R--F--G--S--V--G--Q--D--T--Q--L--C--L--W--D--L--T--E--D--I--L--F--P--H--Q--P--L--S--R--A--R--T-
GTATCGGTTTGGTTCCGTGGGCCAGGACACACAGCTCTGTTTATGGGACCTTACAGAAGATATCCTTTTCCCTCACCAACCCCTCTCAAGAGCAAGGACA
 ::.:: :::::.:::::::::::::::::.::::::::..: ::::::::.::.::.::.:::::.:::::.:::::.::::::::.:::::.::::::
CTACCGCTTTGGCTCCGTGGGCCAGGACACGCAGCTCTGCCTCTGGGACCTCACGGAGGACATCCTCTTCCCCCACCAGCCCCTCTCGAGAGCGAGGACA
--Y--R--F--G--S--V--G--Q--D--T--Q--L--C--L--W--D--L--T--E--D--I--L--F--P--H--Q--P--L--S--R--A--R--T-

----------------------------------------------------------------------------------------------------
-H--T--N--V--M--N--A--T--S--P--P--A--G--S--N--G--N--S--V--T--T--P--G--N--S--V--P--P--P--L--P--R--S--
CACACAAATGTCATGAATGCCACGAGTCCTCCTGCTGGAAGCAATGGGAACAGTGTTACAACACCCGGGAACTCTGTGCCGCCTCCTCTGCCACGGTCCA
::::: ::.::::::::.::::::::.::.::.:..:: :::. .:::::::::::. :.::.:: :: ::: : :.:::::: ::.:::::.:::::::
CACACCAACGTCATGAACGCCACGAGCCCCCCCGTCGGCAGCGCCGGGAACAGTGTCTCGACGCCGGGCAACGCGGCGCCGCCGCCCCTGCCGCGGTCCA
-H--T--N--V--M--N--A--T--S--P--P--V--G--S--A--G--N--S--V--S--T--P--G--N--A--A--P--P--P--L--P--R--S--

----------------------------------------------------------------------------------------------------
N--S--L--P--H--S--A--V--S--N--A--G--S--K--S--S--V--M--D--G--A--I--A--S--G--V--S--K--F--A--T--L--S--L
ACAGCCTTCCACATTCAGCAGTCTCAAATGCTGGCAGCAAAAGCAGTGTCATGGACGGGGCCATTGCTTCTGGGGTCAGCAAATTTGCAACACTTTCACT
:::::::.::.::.::.:: :: :: ...:: ::::::::.:::::.:::.. :::::::::.: :: ::.:::::::::::.::.:: ::.::.:: ::
ACAGCCTCCCGCACTCGGCCGTGTCCGGCGCGGGCAGCAAGAGCAGCGTCGCCGACGGGGCCGTGGCGTCCGGGGTCAGCAAGTTCGCCACGCTCTCCCT
N--S--L--P--H--S--A--V--S--G--A--G--S--K--S--S--V--A--D--G--A--V--A--S--G--V--S--K--F--A--T--L--S--L

----------------------------------------------------------------------------------------------------
--H--D--R--K--E--R--H--H--E--K--D--H--K--R--N--H--S--M--G--H--I--S--S--K--S--S--D--K--L--N--L--V--T-
ACATGACCGGAAGGAGAGGCACCACGAGAAAGATCACAAGCGAAATCATAGCATGGGACACATTTCTAGCAAGAGCAGTGACAAACTGAATCTAGTTACC
.::.:: :: ::::: :::::::::::::::::.:::::::::::.::.::::::::::::::.::::::::::::::.:::::::::::.::.::.:: 
GCACGAGCGCAAGGACAGGCACCACGAGAAAGACCACAAGCGAAACCACAGCATGGGACACATCTCTAGCAAGAGCAGCGACAAACTGAACCTGGTCACG
--H--E--R--K--D--R--H--H--E--K--D--H--K--R--N--H--S--M--G--H--I--S--S--K--S--S--D--K--L--N--L--V--T-

----------------------------------------------------------------------------------------------------
-K--T--K--T--D--P--A--K--T--L--G--T--P--L--C--P--R--M--E--D--V--P--L--L--E--P--L--I--C--K--K--I--A--
AAAACCAAAACGGACCCTGCTAAAACTCTGGGAACGCCCCTGTGTCCTCGAATGGAAGATGTTCCCTTGTTAGAGCCGCTGATATGTAAAAAGATAGCAC
:::.:::.::::::::: :::::::::::::: ::: :::::::.:::::.::::::::.:::::::::::::::::::: :: :::::::::::::: :
AAAGCCAGAACGGACCCAGCTAAAACTCTGGGCACGGCCCTGTGCCCTCGGATGGAAGACGTTCCCTTGTTAGAGCCGCTCATCTGTAAAAAGATAGCCC
-K--A--R--T--D--P--A--K--T--L--G--T--A--L--C--P--R--M--E--D--V--P--L--L--E--P--L--I--C--K--K--I--A--

----------------------------------------------------------------------------------------------><----
H--E--R--L--T--V--L--I--F--L--E--D--C--I--V--T--A--C--Q--E--G--F--I--C--T--W--G--R--P--G--K--V--G--S
ATGAGAGACTGACTGTACTAATATTTCTTGAAGACTGTATAGTCACTGCTTGTCAGGAGGGATTTATTTGCACATGGGGAAGGCCTGGTAAAGTGGGCTC
:.::.:::::::: :::.:.:: ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::     
ACGAAAGACTGACGGTATTGATTTTTCTTGAAGACTGTATAGTCACTGCTTGTCAGGAGGGATTTATTTGCACATGGGGAAGGCCTGGTAAAGTG-----
H--E--R--L--T--V--L--I--F--L--E--D--C--I--V--T--A--C--Q--E--G--F--I--C--T--W--G--R--P--G--K--V------

------------------------------------------------>
--L--S--S--P--S--Q--A--S--S--P--G--G--T--V--V--*-
ATTGTCATCCCCAAGCCAGGCCAGTTCTCCAGGTGGAACTGTAGTGTAG
                                                 
-------------------------------------------------
-------------------------------------------------

Pig Consensus Sequence

>BGISUST0000879922
ATGGCGACGGAGGGAGGAGGGAAGGAGATGAACGAGATTAAGACCCAATTCACCACCCGGGAAGGTCTGTACAAGCTGCTGCCGCACTCGGAGTACAGCC
GGCCCAACCGGGTGCCCTTCAGCTCGCAGGGATCCAACCCTGTCCGCGTCTCCTTCGTAAACCTCAACGACCAGTCTGGCAACGGCGACCGCCTCTGCTT
CAATGTGGGCCGGGAGCTCTACTTCTATATCTACAAGGGGGTCCGCAAGGCTGCTGACTTGAGTAAACCAATAGATAAAAGGATATACAAAGGAACACAG
CCTACTTGTCATGACTTCAACCACCTCACAGCCACAGCAGAAAGTGTCTCTCTCCTAGTGGGCTTTTCCGCAGGCCAAGTCCAGCTTATAGACCCAATCA
AGAAagAAACTAGCAAACTATTTAATGAGGAAAGACTAATAGACAAGTCGCGAGTAACCTGTGTCAGATGGGTTCCTGGTTCGGAAAGCCTGTTCCTAGT
AGCCCATTCGAGCGGGAACATGTACTTGTATAATGTGGAGCACGCTTGTGGCACCACAGCCCCCCACTACCAGCTTCTGAAGCAGGGAGAGAGCTTGGCC
GTGCACACTTGCAAGAGCAAATCCACGAGGAACCCTCTCCTTAAGTGGACGGTGGGCGAGGGGGCCCTCAACGAGTTTGCTTTCTCCCCAGATGGCAAGT
TCTTGGCGTGCGTGAGCCAGGACGGCTTCCTGCGGGTGTTCAACTTTGACTCGGTGGAGCTGCACGGCACCATGAAAAGCTACTTTGGAGGCTTGCTGTG
CGTGTGCTGGAGCCCCGACGGCAAGTACATTGTGACGGGCGGCGAGGACGACCTGGTGACGGTCTGGTCTTTTGGAGACCGCCGGGTGATAGCGCGGGGC
CACGGGCACAAGTCCTGGGTCAGCGTGGTGGCCTTCGACCCCTACACCACCAGCGTGGAGGAGAGCGACCCTCTGGAGCTGAGTGGCAGCGACGAGGACT
TCCAAGACCTTCTGCACTTCGGCCGAGACCGCGCCAACAGCACCCAGTCCCGGCTGTCCAAGCGGAACTCGACCGAGAGCCGCCCCGTCAGCGTCACCTA
CCGCTTTGGCTCCGTGGGCCAGGACACGCAGCTCTGCCTCTGGGACCTCACGGAGGACATCCTCTTCCCCCACCAGCCCCTCTCGAGAGCGAGGACACAC
ACCAACGTCATGAACGCCACGAGCCCCCCCGTCGGCAGCGCCGGGAACAGTGTCTCGACGCCGGGCAACGCGGCGCCGCCGCCCCTGCCGCGGTCCAACA
GCCTCCCGCACTCGGCCGTGTCCGGCGCGGGCAGCAAGAGCAGCGTCGCCGACGGGGCCGTGGCGTCCGGGGTCAGCAAGTTCGCCACGCTCTCCCTGCA
CGAGCGCAAGGACAGGCACCACGAGAAAGACCACAAGCGAAACCACAGCATGGGACACATCTCTAGCAAGAGCAGCGACAAACTGAACCTGGTCACGAAA
GCCAGAACGGACCCAGCTAAAACTCTGGGCACGGCCCTGTGCCCTCGGATGGAAGACGTTCCCTTGTTAGAGCCGCTCATCTGTAAAAAGATAGCCCACG
AAAGACTGACGGTATTGATTTTTCTTGAAGACTGTATAGTCACTGCTTGTCAGGAGGGATTTATTTGCACATGGGGAAGGCCTGGTAAAGTG--------
----------------------------------------------


>BGISUSP0000879922
MATEGGGKEMNEIKTQFTTREGLYKLLPHSEYSRPNRVPFSSQGSNPVRVSFVNLNDQSGNGDRLCFNVGRELYFYIYKGVRKAADLSKPIDKRIYKGTQ
PTCHDFNHLTATAESVSLLVGFSAGQVQLIDPIKKETSKLFNEERLIDKSRVTCVRWVPGSESLFLVAHSSGNMYLYNVEHACGTTAPHYQLLKQGESLA
VHTCKSKSTRNPLLKWTVGEGALNEFAFSPDGKFLACVSQDGFLRVFNFDSVELHGTMKSYFGGLLCVCWSPDGKYIVTGGEDDLVTVWSFGDRRVIARG
HGHKSWVSVVAFDPYTTSVEESDPLELSGSDEDFQDLLHFGRDRANSTQSRLSKRNSTESRPVSVTYRFGSVGQDTQLCLWDLTEDILFPHQPLSRARTH
TNVMNATSPPVGSAGNSVSTPGNAAPPPLPRSNSLPHSAVSGAGSKSSVADGAVASGVSKFATLSLHERKDRHHEKDHKRNHSMGHISSKSSDKLNLVTK
ARTDPAKTLGTALCPRMEDVPLLEPLICKKIAHERLTVLIFLEDCIVTACQEGFICTWGRPGKV------------------