Sequences
EST Library Info
cst1Stomach - RNA from China
fbs1Unavailable
lin2Large intestine
med1Mediastinum
mgp1Mammary gland - 7 days pre birth
pfco1Unavailable
pliv2Unavailable
spl3Spleen
ste1M. Semitendinosus
tra1Trachea
Clusters
Oligos
SNPs

Gene ID ENSG00000169131 (click for geneview)
Transcript ID ENST00000335815(link to ensembl)
Symbol ZNF354A
Localtion Chromosome:5:178071137:178090309:-1 band: 5q35.3
Description Zinc finger protein 354A (Transcription factor 17) (Zinc finger protein eZNF). [Source:Uniprot/SWISSPROT;Acc:O60765]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------><------------------------------------------------------------------
-M--A--A--G--Q--R--E--A--R--P--Q--V--S--L--T--F--E--D--V--A--V--L--F--T--R--D--E--W--R--K--L--A--P--
ATGGCTGCTGGGCAGCGGGAAGCGAGGCCCCAGGTGTCACTGACGTTTGAGGATGTGGCTGTGCTGTTTACCCGAGATGAGTGGAGAAAGCTGGCCCCTT
                                 ::: :: :::::::.:::::.::::::::::: ::. : :::::::::::::::::::::: .::::
---------------------------------GTGACAGTGACGTTCGAGGACGTGGCTGTGCTCTTCTCACGAGATGAGTGGAGAAAGCTGGGTCCTT
----------------------------------V--T--V--T--F--E--D--V--A--V--L--F--S--R--D--E--W--R--K--L--G--P--

-----------------------------------------------------------><---------------------------------------
S--Q--R--N--L--Y--R--D--V--M--L--E--N--Y--R--N--L--V--S--L--G--L--P--F--T--K--P--K--V--I--S--L--L--Q
CTCAGAGAAACTTGTACCGGGATGTGATGCTGGAGAACTATAGGAACCTGGTCTCACTGGGGCTCCCATTTACCAAACCAAAAGTGATCTCCCTGTTGCA
::::::..::::::::::..::.:::::::::::::::::::: :::::::::::::::   ::::::::: ::::::: ::.:::::::::::::::::
CTCAGAAGAACTTGTACCAAGACGTGATGCTGGAGAACTATAGCAACCTGGTCTCACTG---CTCCCATTTTCCAAACCCAAGGTGATCTCCCTGTTGCA
S--Q--K--N--L--Y--Q--D--V--M--L--E--N--Y--S--N--L--V--S--L-----L--P--F--S--K--P--K--V--I--S--L--L--Q

-------------------------------------------------------><-------------------------------------------
--Q--G--E--D--P--W--E--V--E--K--D--G--S--G--V--S--S--L--G--S--K--S--S--H--K--T--T--K--S--T--Q--T--Q-
GCAAGGAGAAGATCCCTGGGAGGTGGAGAAAGACGGTTCTGGCGTCTCCTCTCTAGGATCGAAGAGCAGTCATAAAACCACAAAGTCAACGCAAACACAA
:::::::::::::::::::.::::.:::::::: .::.::::                : ::::::::::.:::::::.::::::::::: ::.::::::
GCAAGGAGAAGATCCCTGGAAGGTAGAGAAAGAAAGTCCTGGA---------------TGGAAGAGCAGTTATAAAACTACAAAGTCAACTCAGACACAA
--Q--G--E--D--P--W--K--V--E--K--E--S--P--G-----------------W--K--S--S--Y--K--T--T--K--S--T--Q--T--Q-

----------------------------------------------------------------------------------------------------
-D--S--S--F--Q--G--L--I--L--K--R--S--N--R--N--V--P--W--D--L--K--L--E--K--P--Y--I--Y--E--G--R--L--E--
GACTCTTCATTTCAGGGACTGATACTGAAAAGATCCAACAGGAATGTACCTTGGGATTTGAAATTAGAAAAGCCTTACATATATGAAGGCAGATTAGAGA
::.:::::::::::::..:::::: ::::::::::::: ::::::: :::.:::.:.::.::::.::::::.::.:..:::::.::::.:::::::::::
GATTCTTCATTTCAGGAGCTGATAATGAAAAGATCCAAAAGGAATGGACCCTGGAACTTAAAATCAGAAAAACCCTGTATATACGAAGACAGATTAGAGA
-D--S--S--F--Q--E--L--I--M--K--R--S--K--R--N--G--P--W--N--L--K--S--E--K--P--C--I--Y--E--D--R--L--E--

----------------------------------------------------------------------------------------------------
K--K--Q--D--K--K--G--S--F--Q--I--V--S--A--T--H--K--K--I--P--T--I--E--R--S--H--K--N--T--E--L--S--Q--N
AAAAGCAGGATAAAAAGGGAAGTTTTCAGATAGTTTCAGCCACCCACAAAAAAATCCCCACTATAGAAAGAAGCCATAAAAATACTGAATTGAGCCAAAA
:::::::::: :::::.:.:::: ::::::::::::::::.::.:: :: :::::::.::::.:::::::::. ::::::::::::::::. .:::::::
AAAAGCAGGAGAAAAAAGAAAGTGTTCAGATAGTTTCAGCTACTCAAAATAAAATCCTCACTGTAGAAAGAAAACATAAAAATACTGAATCTGGCCAAAA
K--K--Q--E--K--K--E--S--V--Q--I--V--S--A--T--Q--N--K--I--L--T--V--E--R--K--H--K--N--T--E--S--G--Q--N

----------------------------------------------------------------------------------------------------
--F--S--P--K--S--V--L--I--R--Q--Q--I--L--P--R--E--K--T--P--P--K--C--E--I--Q--G--N--S--L--K--Q--N--S-
CTTCAGCCCAAAGTCAGTGCTTATTAGGCAACAGATACTTCCCAGAGAAAAAACACCACCAAAATGTGAAATACAAGGAAACAGCCTCAAACAGAATTCA
: :::::::::::::::: :.:.:::::: ::::::. :::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::
CATCAGCCCAAAGTCAGTCCCTGTTAGGCCACAGATGGTTCCCAGAGAAAAAACACCACCAAAATGTGAAATACAAGGAAACAGCTTCAAACAGAATTCA
--I--S--P--K--S--V--P--V--R--P--Q--M--V--P--R--E--K--T--P--P--K--C--E--I--Q--G--N--S--F--K--Q--N--S-

----------------------------------------------------------------------------------------------------
-Q--L--L--N--Q--P--K--I-----T--A--D--K--R--Y--K--C--S--L--C--E--K--T--F--I--N--T--S--S--L--R--K--H--
CAATTACTTAATCAACCAAAAATT---ACAGCAGATAAACGCTATAAATGTAGTCTGTGTGAAAAAACCTTCATTAACACTTCATCCCTTCGTAAACATG
 : ::::::::::::: ::::: .   :::::::. ::::: ::::: :::::: :::::::.:::::::::::.::.::::::::.:::::::::::::
AATTTACTTAATCAACAAAAAAACAACACAGCAGGGAAACGGTATAACTGTAGTATGTGTGAGAAAACCTTCATCAATACTTCATCTCTTCGTAAACATG
-N--L--L--N--Q--Q--K--N--N--T--A--G--K--R--Y--N--C--S--M--C--E--K--T--F--I--N--T--S--S--L--R--K--H--

----------------------------------------------------------------------------------------------------
E--K--N--H--S--G--E--K--L--F--K--C--K--E--C--S--K--A--F--S--Q--S--S--A--L--I--Q--H--Q--I--T--H--T--G
AGAAAAACCATAGTGGAGAGAAACTATTTAAGTGTAAAGAATGTTCAAAAGCCTTTAGCCAAAGTTCAGCTCTTATTCAACATCAAATAACGCATACTGG
:::::::::::::::::::::::.:::::::.:::::::: ::::::::::: ::::.:::::::::::::::::::::::::::.::::: ::::::::
AGAAAAACCATAGTGGAGAGAAATTATTTAAATGTAAAGACTGTTCAAAAGCGTTTAACCAAAGTTCAGCTCTTATTCAACATCAGATAACTCATACTGG
E--K--N--H--S--G--E--K--L--F--K--C--K--D--C--S--K--A--F--N--Q--S--S--A--L--I--Q--H--Q--I--T--H--T--G

----------------------------------------------------------------------------------------------------
--E--K--P--Y--I--C--K--E--C--G--K--A--F--T--L--S--T--S--L--Y--K--H--L--R--T--H--T--V--E--K--S--Y--R-
AGAGAAACCCTACATATGTAAAGAATGTGGGAAAGCCTTTACTCTCAGTACATCCCTTTATAAACATCTAAGAACCCATACTGTGGAGAAATCCTACAGA
:::.::::::::.::::::::::::::::::::::::::.:::::::::::::::::::::::.::..::::::: :::::::::::.::::::::.:::
AGAAAAACCCTATATATGTAAAGAATGTGGGAAAGCCTTCACTCTCAGTACATCCCTTTATAAGCACTTAAGAACACATACTGTGGAAAAATCCTATAGA
--E--K--P--Y--I--C--K--E--C--G--K--A--F--T--L--S--T--S--L--Y--K--H--L--R--T--H--T--V--E--K--S--Y--R-

----------------------------------------------------------------------------------------------------
-C--K--E--C--G--K--S--F--S--R--R--S--G--L--F--I--H--Q--K--I--H--A--E--E--N--P--C--K--Y--N--P--G--R--
TGTAAAGAATGTGGTAAATCCTTCAGCCGAAGGTCAGGCCTTTTTATACATCAAAAAATTCATGCTGAAGAAAACCCTTGTAAGTATAATCCGGGTAGGA
:::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::.:::::::.::::::.::.:.:::.:::::.::.::: :::
TGTAAAGAATGTGGTAAATCCTTCAGCCGAAGGTCAGGCCTTTTTATACATCAGAAAATCCATGCTGGAGAAAATCCCTATAAATATAACCCAGGTCGGA
-C--K--E--C--G--K--S--F--S--R--R--S--G--L--F--I--H--Q--K--I--H--A--G--E--N--P--Y--K--Y--N--P--G--R--

----------------------------------------------------------------------------------------------------
K--A--S--S--C--S--T--S--L--S--G--C--Q--R--I--H--S--R--K--K--S--Y--L--C--N--E--C--G--N--T--F--K--S--S
AGGCATCTAGTTGCAGCACATCCCTTTCTGGATGTCAAAGAATTCATTCTAGAAAGAAGTCCTACTTATGTAATGAATGTGGCAACACCTTTAAGTCTAG
:::::::.::::::::::::::::::.::::::::::.:::::::::::.::::::::::::::.:::::::::::::::::::::::::::::::::::
AGGCATCCAGTTGCAGCACATCCCTTCCTGGATGTCAGAGAATTCATTCCAGAAAGAAGTCCTATTTATGTAATGAATGTGGCAACACCTTTAAGTCTAG
K--A--S--S--C--S--T--S--L--P--G--C--Q--R--I--H--S--R--K--K--S--Y--L--C--N--E--C--G--N--T--F--K--S--S

----------------------------------------------------------------------------------------------------
--S--S--L--R--Y--H--Q--R--I--H--T--G--E--K--P--F--K--C--S--E--C--G--R--A--F--S--Q--S--A--S--L--I--Q-
CTCATCCCTTCGTTATCATCAGAGAATTCACACTGGAGAGAAGCCTTTTAAATGTAGTGAATGTGGGAGAGCCTTCAGCCAGAGTGCCTCTCTTATTCAA
.:::::.:::::::::::::::::::::::::: ::::::::::::::::::::::::::.:::::::::::::::::.:::::::: :::::.::.::.
TTCATCTCTTCGTTATCATCAGAGAATTCACACAGGAGAGAAGCCTTTTAAATGTAGTGAGTGTGGGAGAGCCTTCAGTCAGAGTGCATCTCTCATCCAG
--S--S--L--R--Y--H--Q--R--I--H--T--G--E--K--P--F--K--C--S--E--C--G--R--A--F--S--Q--S--A--S--L--I--Q-

----------------------------------------------------------------------------------------------------
-H--E--R--I--H--T--G--E--K--P--Y--R--C--N--E--C--G--K--G--F--T--S--I--S--R--L--N--R--H--R--I--I--H--
CATGAAAGAATTCACACCGGAGAAAAGCCCTATAGATGCAATGAATGTGGGAAAGGCTTTACTTCTATTTCACGACTTAATAGACACCGAATCATTCATA
:::::::::::::::::.::::::::.:::::::::::.:::::::::::.::::::::.:::::::::::::::::::::::::::::::: :::::::
CATGAAAGAATTCACACTGGAGAAAAACCCTATAGATGTAATGAATGTGGAAAAGGCTTCACTTCTATTTCACGACTTAATAGACACCGAATAATTCATA
-H--E--R--I--H--T--G--E--K--P--Y--R--C--N--E--C--G--K--G--F--T--S--I--S--R--L--N--R--H--R--I--I--H--

----------------------------------------------------------------------------------------------------
T--G--E--K--F--Y--N--C--N--E--C--G--K--A--L--S--S--H--S--T--L--I--I--H--E--R--I--H--T--G--E--K--P--C
CTGGAGAGAAGTTTTATAATTGTAATGAATGTGGTAAAGCCTTAAGCTCCCACTCAACACTTATTATTCACGAGCGAATTCATACTGGAGAAAAACCATG
:::: :::::::::::::::::::::::::::::::::::::::::.:::::.::::::::.::::::::.::.:::::::::::::::::.::::::::
CTGGTGAGAAGTTTTATAATTGTAATGAATGTGGTAAAGCCTTAAGTTCCCATTCAACACTCATTATTCATGAACGAATTCATACTGGAGAGAAACCATG
T--G--E--K--F--Y--N--C--N--E--C--G--K--A--L--S--S--H--S--T--L--I--I--H--E--R--I--H--T--G--E--K--P--C

----------------------------------------------------------------------------------------------------
--K--C--K--V--C--G--K--A--F--R--Q--S--S--A--L--I--Q--H--Q--R--M--H--T--G--E--R--P--Y--K--C--N--E--C-
TAAATGTAAAGTATGTGGAAAAGCCTTCAGACAGAGTTCAGCTCTCATTCAACATCAGAGAATGCATACTGGAGAAAGACCCTATAAATGTAACGAGTGT
:::.::::::::.:::::.::::::::::::::.:::::::: :::::::::::::::::::::::.::::::::::::::.:::::::::::.::::::
TAAGTGTAAAGTGTGTGGGAAAGCCTTCAGACAAAGTTCAGCACTCATTCAACATCAGAGAATGCACACTGGAGAAAGACCTTATAAATGTAATGAGTGT
--K--C--K--V--C--G--K--A--F--R--Q--S--S--A--L--I--Q--H--Q--R--M--H--T--G--E--R--P--Y--K--C--N--E--C-

----------------------------------------------------------------------------------------------------
-G--K--T--F--R--C--N--S--S--L--S--N--H--Q--R--I--H--T--G--E--K--P--Y--R--C--E--E--C--G--I--S--F--G--
GGGAAAACATTCAGGTGTAACTCATCACTTAGTAATCACCAGAGAATTCATACTGGAGAGAAACCATATCGATGTGAGGAATGTGGGATATCTTTTGGCC
::::::::.::::::::::::::::: :::::.:::::.::: :::::::::: ::::::::::::::::::::.::.::::::::::::::::::::::
GGGAAAACGTTCAGGTGTAACTCATCTCTTAGCAATCATCAGCGAATTCATACAGGAGAGAAACCATATCGATGCGAAGAATGTGGGATATCTTTTGGCC
-G--K--T--F--R--C--N--S--S--L--S--N--H--Q--R--I--H--T--G--E--K--P--Y--R--C--E--E--C--G--I--S--F--G--

----------------------------------------------------------------------------------------------------
Q--S--S--A--L--I--Q--H--R--R--I--H--T--G--E--K--P--F--K--C--N--T--C--G--K--T--F--R--Q--S--S--S--R--I
AAAGTTCAGCTCTTATTCAGCATCGAAGGATTCATACAGGAGAAAAACCCTTTAAATGTAATACATGTGGAAAAACTTTTAGACAAAGCTCATCACGTAT
:::::::::::::::::::::::::.::::::::.::::::::.::::::::.::::::::.::::::::.:::::.:::::.:::::::::::::::::
AAAGTTCAGCTCTTATTCAGCATCGGAGGATTCACACAGGAGAGAAACCCTTCAAATGTAACACATGTGGGAAAACCTTTAGGCAAAGCTCATCACGTAT
Q--S--S--A--L--I--Q--H--R--R--I--H--T--G--E--K--P--F--K--C--N--T--C--G--K--T--F--R--Q--S--S--S--R--I

----------------------------------------------------------------------------------------------------
--A--H--Q--R--I--H--T--G--E--K--P--Y--E--C--N--T--C--G--K--L--F--N--H--R--S--S--L--T--N--H--Y--K--I-
TGCACATCAGAGAATTCATACTGGAGAGAAACCCTATGAATGTAATACATGTGGGAAACTTTTCAACCATAGGTCATCCCTTACTAATCATTATAAAATT
::: :::::::::::::::::::::::::::::.:::::::::::.::::::::::::::::::::.::.::.::::: :::::::::::::::::::::
TGCCCATCAGAGAATTCATACTGGAGAGAAACCTTATGAATGTAACACATGTGGGAAACTTTTCAATCACAGATCATCACTTACTAATCATTATAAAATT
--A--H--Q--R--I--H--T--G--E--K--P--Y--E--C--N--T--C--G--K--L--F--N--H--R--S--S--L--T--N--H--Y--K--I-

-------------------->
-H--I--E--E--D--P--*-
CATATCGAAGAGGACCCCTAG
:::::.::::::.::::::::
CATATTGAAGAGAACCCCTAG
-H--I--E--E--N--P--*-

Pig Consensus Sequence

>BGISUST0000882525
---------------------------------GTGACAGTGACGTTCGAGGACGTGGCTGTGCTCTTCTCACGAGATGAGTGGAGAAAGCTGGGTCCTT
CTCAGAAGAACTTGTACCAAGACGTGATGCTGGAGAACTATAGCAACCTGGTCTCACTG---CTCCCATTTTCCAAACCCAAGGTGATCTCCCTGTTGCA
GCAAGGAGAAGATCCCTGGAAGGTAGAGAAAGAAAGTCCTGGA---------------TGGAAGAGCAGTTATAAAACTACAAAGTCAACTCAGACACAA
GATTCTTCATTTCAGGAGCTGATAATGAAAAGATCCAAAAGGAATGGACCCTGGAACTTAAAATCAGAAAAACCCTGTATATACGAAGACAGATTAGAGA
AAAAGCAGGAGAAAAAAGAAAGTGTTCAGATAGTTTCAGCTACTCAAAATAAAATCCTCACTGTAGAAAGAAAACATAAAAATACTGAATCTGGCCAAAA
CATCAGCCCAAAGTCAGTCCCTGTTAGGCCACAGATGGTTCCCAGAGAAAAAACACCACCAAAATGTGAAATACAAGGAAACAGCTTCAAACAGAATTCA
AATTTACTTAATCAACAAAAAAACAACACAGCAGGGAAACGGTATAACTGTAGTATGTGTGAGAAAACCTTCATCAATACTTCATCTCTTCGTAAACATG
AGAAAAACCATAGTGGAGAGAAATTATTTAAATGTAAAGACTGTTCAAAAGCGTTTAACCAAAGTTCAGCTCTTATTCAACATCAGATAACTCATACTGG
AGAAAAACCCTATATATGTAAAGAATGTGGGAAAGCCTTCACTCTCAGTACATCCCTTTATAAGCACTTAAGAACACATACTGTGGAAAAATCCTATAGA
TGTAAAGAATGTGGTAAATCCTTCAGCCGAAGGTCAGGCCTTTTTATACATCAGAAAATCCATGCTGGAGAAAATCCCTATAAATATAACCCAGGTCGGA
AGGCATCCAGTTGCAGCACATCCCTTCCTGGATGTCAGAGAATTCATTCCAGAAAGAAGTCCTATTTATGTAATGAATGTGGCAACACCTTTAAGTCTAG
TTCATCTCTTCGTTATCATCAGAGAATTCACACAGGAGAGAAGCCTTTTAAATGTAGTGAGTGTGGGAGAGCCTTCAGTCAGAGTGCATCTCTCATCCAG
CATGAAAGAATTCACACTGGAGAAAAACCCTATAGATGTAATGAATGTGGAAAAGGCTTCACTTCTATTTCACGACTTAATAGACACCGAATAATTCATA
CTGGTGAGAAGTTTTATAATTGTAATGAATGTGGTAAAGCCTTAAGTTCCCATTCAACACTCATTATTCATGAACGAATTCATACTGGAGAGAAACCATG
TAAGTGTAAAGTGTGTGGGAAAGCCTTCAGACAAAGTTCAGCACTCATTCAACATCAGAGAATGCACACTGGAGAAAGACCTTATAAATGTAATGAGTGT
GGGAAAACGTTCAGGTGTAACTCATCTCTTAGCAATCATCAGCGAATTCATACAGGAGAGAAACCATATCGATGCGAAGAATGTGGGATATCTTTTGGCC
AAAGTTCAGCTCTTATTCAGCATCGGAGGATTCACACAGGAGAGAAACCCTTCAAATGTAACACATGTGGGAAAACCTTTAGGCAAAGCTCATCACGTAT
TGCCCATCAGAGAATTCATACTGGAGAGAAACCTTATGAATGTAACACATGTGGGAAACTTTTCAATCACAGATCATCACTTACTAATCATTATAAAATT
CATATTGAAGAGAACCCC


>BGISUSP0000882525
-----------VTVTFEDVAVLFSRDEWRKLGPSQKNLYQDVMLENYSNLVSL-LPFSKPKVISLLQQGEDPWKVEKESPG-----WKSSYKTTKSTQTQ
DSSFQELIMKRSKRNGPWNLKSEKPCIYEDRLEKKQEKKESVQIVSATQNKILTVERKHKNTESGQNISPKSVPVRPQMVPREKTPPKCEIQGNSFKQNS
NLLNQQKNNTAGKRYNCSMCEKTFINTSSLRKHEKNHSGEKLFKCKDCSKAFNQSSALIQHQITHTGEKPYICKECGKAFTLSTSLYKHLRTHTVEKSYR
CKECGKSFSRRSGLFIHQKIHAGENPYKYNPGRKASSCSTSLPGCQRIHSRKKSYLCNECGNTFKSSSSLRYHQRIHTGEKPFKCSECGRAFSQSASLIQ
HERIHTGEKPYRCNECGKGFTSISRLNRHRIIHTGEKFYNCNECGKALSSHSTLIIHERIHTGEKPCKCKVCGKAFRQSSALIQHQRMHTGERPYKCNEC
GKTFRCNSSLSNHQRIHTGEKPYRCEECGISFGQSSALIQHRRIHTGEKPFKCNTCGKTFRQSSSRIAHQRIHTGEKPYECNTCGKLFNHRSSLTNHYKI
HIEENP