Sequences
EST Library Info
ebs1Foetus 50 days, brain stem
Clusters
Oligos
SNPs

Gene ID ENSG00000146090 (click for geneview)
Transcript ID ENST00000335927(link to ensembl)
Symbol RASGEF1C
Localtion Chromosome:5:179460402:179568745:-1 band: 5q35.3
Description RasGEF domain family, member 1C [Source:RefSeq_peptide;Acc:NP_778232]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-A--A--A--A--A--A--G--G--A--P--V--R--G--A--E--A--R--T--G--S--C--P--W--A--G--P--G--V--P--A--R--R--E--
GCGGCGGCGGCGGCGGCGGGCGGCGCCCCGGTCCGCGGCGCCGAGGCTCGCACCGGGAGCTGCCCATGGGCCGGGCCCGGAGTTCCGGCGCGCCGGGAGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-><-------------------------------------------------------------------------------------------------
P--A--D--M--P--Q--T--L--S--A--S--D--M--V--T--P--G--S--L--S--P--P--P--T--E--P--T--D--G--E--Q--A--G--Q
CGGCAGACATGCCACAGACGCTGAGTGCCTCCGACATGGTCACCCCAGGCAGCCTCAGCCCACCCCCCACCGAGCCCACAGATGGCGAACAGGCTGGGCA
  ::::.:::::: :.:::.:::::..:::::::::::::::::::::::::::::.::::::::::.::.::::::::.::::::::.:::::::::::
--GCAGGCATGCCCCGGACACTGAGCACCTCCGACATGGTCACCCCAGGCAGCCTCGGCCCACCCCCTACTGAGCCCACGGATGGCGAGCAGGCTGGGCA
---A--G--M--P--R--T--L--S--T--S--D--M--V--T--P--G--S--L--G--P--P--P--T--E--P--T--D--G--E--Q--A--G--Q

------------------------------------------------------------------------------------><--------------
--P--L--L--D--G--A--P--S--S--A--S--L--E--T--L--I--Q--H--L--V--P--T--A--D--Y--Y--P--E--K--A--Y--I--F-
GCCCCTCCTGGATGGAGCGCCATCCTCAGCCTCCCTGGAAACACTGATCCAGCACCTGGTGCCCACAGCCGACTACTACCCCGAGAAAGCCTACATCTTC
:::::::::::::::: : :::::::::::::::::::: :: ::::::::::::                              :::::::::  ::::
GCCCCTCCTGGATGGACCTCCATCCTCAGCCTCCCTGGACACCCTGATCCAGCAC------------------------------AAAGCCTACTNCTTC
--P--L--L--D--G--P--P--S--S--A--S--L--D--T--L--I--Q--H--------------------------------K--A--Y--X--F-

----------------------------------------------------------------------------------------------------
-T--F--L--L--S--S--R--L--F--I--E--P--R--E--L--L--A--R--V--C--H--L--C--I--E--Q--Q--Q--L--D--K--P--V--
ACCTTCCTGCTGAGCTCTCGCCTCTTCATCGAGCCCCGGGAGCTCCTGGCCCGGGTCTGCCACCTGTGCATCGAGCAGCAGCAGCTGGACAAGCCGGTGC
:::::::::::::::::.::::: :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: ::::.::::
ACCTTCCTGCTGAGCTCCCGCCTGTTCATCGAGCCCCGGGAGCTCCTGGCCCGGGTCTGCCACCTGTGCATCGAGCAGCAGCAGCTGGACCAGCCAGTGC
-T--F--L--L--S--S--R--L--F--I--E--P--R--E--L--L--A--R--V--C--H--L--C--I--E--Q--Q--Q--L--D--Q--P--V--

-------><-------------------------------------------------------------------------------------------
L--D--K--A--R--V--R--K--F--G--P--K--L--L--Q--L--L--A--E--W--T--E--T--F--P--R--D--F--Q--E--E--S--T--I
TGGACAAGGCCCGGGTCCGGAAGTTCGGCCCCAAACTGCTGCAGCTGTTGGCCGAGTGGACCGAGACCTTCCCAAGGGACTTCCAGGAAGAGTCGACTAT
:::::::::::::::::::::::::.:::::::::::::: :::.:::::.:::::::::::::::: :::::  ::::.::::::::.:::::.::.::
TGGACAAGGCCCGGGTCCGGAAGTTTGGCCCCAAACTGCTCCAGTTGTTGACCGAGTGGACCGAGACGTTCCCCCGGGATTTCCAGGAGGAGTCAACCAT
L--D--K--A--R--V--R--K--F--G--P--K--L--L--Q--L--L--T--E--W--T--E--T--F--P--R--D--F--Q--E--E--S--T--I

---------------------------------------------><-----------------------------------------------------
--G--H--L--K--D--V--V--G--R--I--A--P--C--D--E--A--Y--R--K--R--M--H--Q--L--L--Q--A--L--H--Q--K--L--A-
CGGGCACCTTAAGGACGTCGTGGGCCGCATCGCCCCCTGTGACGAGGCATACCGGAAGAGGATGCATCAGCTCCTACAGGCTCTGCACCAGAAGCTGGCG
  : ::::: :::::::: :::::::::::::::::::::::::::::.:::::.:::::::::::.::::::::.::::::::::::::::::::::::
ATGTCACCTGAAGGACGTGGTGGGCCGCATCGCCCCCTGTGACGAGGCGTACCGAAAGAGGATGCACCAGCTCCTGCAGGCTCTGCACCAGAAGCTGGCG
--C--H--L--K--D--V--V--G--R--I--A--P--C--D--E--A--Y--R--K--R--M--H--Q--L--L--Q--A--L--H--Q--K--L--A-

----------------------------------------------------------------------------------------------------
-A--L--R--Q--G--P--E--G--L--V--G--A--D--K--P--I--S--Y--R--T--K--P--P--A--S--I--H--R--E--L--L--G--V--
GCTCTGCGCCAGGGGCCAGAAGGTCTGGTGGGTGCCGACAAGCCCATCTCCTACAGGACCAAGCCACCAGCCTCCATCCACAGGGAGCTCCTTGGTGTCT
.:.::: ::::::::::::::::.::: :::::::::::::::::::::::::::::::.::::: ::.::::::::.::::::::::::::.::..:::
ACCCTGGGCCAGGGGCCAGAAGGCCTGCTGGGTGCCGACAAGCCCATCTCCTACAGGACTAAGCCTCCGGCCTCCATTCACAGGGAGCTCCTCGGCATCT
-T--L--G--Q--G--P--E--G--L--L--G--A--D--K--P--I--S--Y--R--T--K--P--P--A--S--I--H--R--E--L--L--G--I--

----------------------------------------------><----------------------------------------------------
C--S--D--P--Y--T--L--A--Q--Q--L--T--H--V--E--L--E--R--L--R--H--I--G--P--E--E--F--V--Q--A--F--V--N--K
GCAGCGACCCCTACACACTGGCCCAGCAGCTGACCCACGTGGAACTGGAGCGGCTGCGGCACATCGGGCCTGAGGAGTTTGTCCAGGCCTTTGTGAACAA
::::.:::::::::::::::::.::::::::::::::.:::::.:::::.:::::.::.:::::.::.::::::::::::::::::::.:::::::::::
GCAGTGACCCCTACACACTGGCTCAGCAGCTGACCCATGTGGAGCTGGAACGGCTACGACACATTGGACCTGAGGAGTTTGTCCAGGCTTTTGTGAACAA
C--S--D--P--Y--T--L--A--Q--Q--L--T--H--V--E--L--E--R--L--R--H--I--G--P--E--E--F--V--Q--A--F--V--N--K

---------------------><-----------------------------------------------------------------------------
--D--P--L--A--S--T--K--P--C--F--S--D--K--T--S--N--L--E--A--Y--V--K--W--F--N--R--L--C--Y--L--V--A--T-
GGACCCTCTGGCCAGCACAAAGCCCTGCTTCAGTGACAAGACCAGCAACCTGGAGGCTTATGTGAAATGGTTCAACAGGCTGTGCTACCTGGTGGCAACT
::::::::::::::::::::::                                                                              
GGACCCTCTGGCCAGCACAAAG------------------------------------------------------------------------------
--D--P--L--A--S--T--K-------------------------------------------------------------------------------

-----------><---------------------------------------------------------------------------------------
-E--I--C--M--P--A--K--K--K--Q--R--A--Q--V--I--E--F--F--I--D--V--A--R--E--C--F--N--I--G--N--F--N--S--
GAGATCTGCATGCCAGCCAAGAAGAAGCAGAGGGCCCAGGTGATTGAGTTCTTCATCGACGTGGCCCGCGAGTGCTTCAACATCGGCAACTTCAACTCCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------><------------------------------------------------------------------------------><----
L--M--A--I--I--S--G--M--N--M--S--P--V--S--R--L--K--K--T--W--A--K--V--R--T--A--K--F--F--I--L--E--H--Q
TCATGGCCATCATCTCCGGCATGAACATGAGCCCTGTCTCCAGGCTGAAGAAGACCTGGGCCAAAGTGAGGACGGCCAAGTTTTTCATCCTCGAGCACCA
                 ::::::::::::::::::::::: ::::::::::::::::::::::::::::.:::::::::::::::::::::.:::     
-----------------GGCATGAACATGAGCCCTGTCTCAAGGCTGAAGAAGACCTGGGCCAAAGTGAAGACGGCCAAGTTTTTCATCCTTGAG-----
------------------G--M--N--M--S--P--V--S--R--L--K--K--T--W--A--K--V--K--T--A--K--F--F--I--L--E------

------------------------------------------------------------------------------------------><--------
--M--D--P--T--G--N--F--C--N--Y--R--T--A--L--R--G--A--A--H--R--S--L--T--A--H--S--S--R--E--K--I--V--I-
GATGGACCCAACGGGGAATTTCTGCAACTACAGGACAGCCCTGCGCGGGGCGGCCCACCGCTCCCTGACGGCCCACAGCAGCCGAGAGAAGATTGTCATT
          ::.:::::::::::::::::.::::::::::::::.:::::.::::::::::::::::: ::::::::::::::.::::::::.:::::.
----------ACAGGGAATTTCTGCAACTATAGGACAGCCCTGCGTGGGGCAGCCCACCGCTCCCTGACCGCCCACAGCAGCCGGGAGAAGATCGTCATC
-----------T--G--N--F--C--N--Y--R--T--A--L--R--G--A--A--H--R--S--L--T--A--H--S--S--R--E--K--I--V--I-

--------------------------------------------------------------------------------------><------------
-P--F--F--S--L--L--I--K--D--I--Y--F--L--N--E--G--C--A--N--R--L--P--N--G--H--V--N--F--E--K--F--L--E--
CCTTTCTTCAGCCTGCTCATCAAAGACATCTACTTCCTGAATGAGGGCTGCGCCAACCGCCTTCCCAATGGACACGTCAACTTTGAGAAATTCCTGGAGC
::.:::::::::::::::::::::::::::::::::::.::.::::::::.:::::::::::.:::::::::::::::::.:::::::::::.:::::::
CCCTTCTTCAGCCTGCTCATCAAAGACATCTACTTCCTAAACGAGGGCTGTGCCAACCGCCTCCCCAATGGACACGTCAATTTTGAGAAATTTCTGGAGC
-P--F--F--S--L--L--I--K--D--I--Y--F--L--N--E--G--C--A--N--R--L--P--N--G--H--V--N--F--E--K--F--L--E--

----------------------------------------------------------------------------------------------------
L--A--K--Q--V--G--E--F--I--T--W--K--Q--V--E--C--P--F--E--Q--D--A--S--I--T--H--Y--L--Y--T--A--P--I--F
TGGCCAAGCAGGTGGGGGAGTTCATCACCTGGAAACAAGTGGAGTGTCCCTTCGAGCAAGACGCCAGCATCACCCACTACCTGTACACCGCCCCCATCTT
::::::::::.:: ::.::::::::::: ::::::::::::::::::::::::::.:::::: ::::.:::::::::::::::.::::::::::::::::
TGGCCAAGCAAGTTGGAGAGTTCATCACATGGAAACAAGTGGAGTGTCCCTTCGAACAAGACCCCAGTATCACCCACTACCTGCACACCGCCCCCATCTT
L--A--K--Q--V--G--E--F--I--T--W--K--Q--V--E--C--P--F--E--Q--D--P--S--I--T--H--Y--L--H--T--A--P--I--F

----------><-----------------------------------------------------------------------><---------------
--S--E--D--G--L--Y--L--A--S--Y--E--S--E--S--P--E--N--Q--T--E--K--E--R--W--K--A--L--R--S--S--I--L--G-
CAGTGAGGATGGTCTTTATTTGGCTTCTTACGAAAGTGAGAGCCCAGAGAACCAAACAGAAAAAGAAAGATGGAAAGCTCTAAGATCTTCTATTTTGGGG
:::.::::::   :::::::::::::::::.:::::::::::::::::::::::::::::::::::.::.:::::: :::::                  
CAGCGAGGAT---CTTTATTTGGCTTCTTATGAAAGTGAGAGCCCAGAGAACCAAACAGAAAAAGAGAGGTGGAAATCTCTA------------------
--S--E--D-----L--Y--L--A--S--Y--E--S--E--S--P--E--N--Q--T--E--K--E--R--W--K--S--L-------------------

-------->
-K--T--*-
AAGACATGA
         
---------
---------

Pig Consensus Sequence

>BGISUST0000885320
----------------------------------------------------------------------------------------------------
--GCAGGCATGCCCCGGACACTGAGCACCTCCGACATGGTCACCCCAGGCAGCCTCGGCCCACCCCCTACTGAGCCCACGGATGGCGAGCAGGCTGGGCA
GCCCCTCCTGGATGGACCTCCATCCTCAGCCTCCCTGGACACCCTGATCCAGCAC------------------------------AAAGCCTACTNCTTC
ACCTTCCTGCTGAGCTCCCGCCTGTTCATCGAGCCCCGGGAGCTCCTGGCCCGGGTCTGCCACCTGTGCATCGAGCAGCAGCAGCTGGACCAGCCAGTGC
TGGACAAGGCCCGGGTCCGGAAGTTTGGCCCCAAACTGCTCCAGTTGTTGACCGAGTGGACCGAGACGTTCCCCCGGGATTTCCAGGAGGAGTCAACCAT
ATGTCACCTGAAGGACGTGGTGGGCCGCATCGCCCCCTGTGACGAGGCGTACCGAAAGAGGATGCACCAGCTCCTGCAGGCTCTGCACCAGAAGCTGGCG
ACCCTGGGCCAGGGGCCAGAAGGCCTGCTGGGTGCCGACAAGCCCATCTCCTACAGGACTAAGCCTCCGGCCTCCATTCACAGGGAGCTCCTCGGCATCT
GCAGTGACCCCTACACACTGGCTCAGCAGCTGACCCATGTGGAGCTGGAACGGCTACGACACATTGGACCTGAGGAGTTTGTCCAGGCTTTTGTGAACAA
GGACCCTCTGGCCAGCACAAAG------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------GGCATGAACATGAGCCCTGTCTCAAGGCTGAAGAAGACCTGGGCCAAAGTGAAGACGGCCAAGTTTTTCATCCTTGAG-----
----------ACAGGGAATTTCTGCAACTATAGGACAGCCCTGCGTGGGGCAGCCCACCGCTCCCTGACCGCCCACAGCAGCCGGGAGAAGATCGTCATC
CCCTTCTTCAGCCTGCTCATCAAAGACATCTACTTCCTAAACGAGGGCTGTGCCAACCGCCTCCCCAATGGACACGTCAATTTTGAGAAATTTCTGGAGC
TGGCCAAGCAAGTTGGAGAGTTCATCACATGGAAACAAGTGGAGTGTCCCTTCGAACAAGACCCCAGTATCACCCACTACCTGCACACCGCCCCCATCTT
CAGCGAGGAT---CTTTATTTGGCTTCTTATGAAAGTGAGAGCCCAGAGAACCAAACAGAAAAAGAGAGGTGGAAATCTCTA------------------
---------


>BGISUSP0000885320
----------------------------------AGMPRTLSTSDMVTPGSLGPPPTEPTDGEQAGQPLLDGPPSSASLDTLIQH----------KAY-F
TFLLSSRLFIEPRELLARVCHLCIEQQQLDQPVLDKARVRKFGPKLLQLLTEWTETFPRDFQEESTICHLKDVVGRIAPCDEAYRKRMHQLLQALHQKLA
TLGQGPEGLLGADKPISYRTKPPASIHRELLGICSDPYTLAQQLTHVELERLRHIGPEEFVQAFVNKDPLASTK--------------------------
---------------------------------------GMNMSPVSRLKKTWAKVKTAKFFILE-----TGNFCNYRTALRGAAHRSLTAHSSREKIVI
PFFSLLIKDIYFLNEGCANRLPNGHVNFEKFLELAKQVGEFITWKQVECPFEQDPSITHYLHTAPIFSED-LYLASYESESPENQTEKERWKSL------
---