Sequences
EST Library Info
cbl2Blood
nlu1Newborn 115 days, lung
pliv1Unavailable
plun1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000135604 (click for geneview)
Transcript ID ENST00000336030(link to ensembl)
Symbol STX11
Localtion Chromosome:6:144513362:144551194:1 band: 6q24.2
Description Syntaxin-11. [Source:Uniprot/SWISSPROT;Acc:O75558]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--K--D--R--L--A--E--L--L--D--L--S--K--Q--Y--D--Q--Q--F--P--D--G--D--D--E--F--D--S--P--H--E--D--I--
ATGAAAGACCGGCTAGCAGAACTTCTGGACTTGTCCAAGCAATATGACCAGCAGTTCCCAGACGGGGACGATGAGTTTGACTCGCCCCACGAGGACATCG
:::::.::::::::::.:::::::.:::: ::. ::::::: :::::::::::::::::::: ..::::::::: ::::::::.::.:::::::::::::
ATGAAGGACCGGCTAGTAGAACTTTTGGAGTTAACCAAGCACTATGACCAGCAGTTCCCAGAAAAGGACGATGACTTTGACTCACCTCACGAGGACATCG
-M--K--D--R--L--V--E--L--L--E--L--T--K--H--Y--D--Q--Q--F--P--E--K--D--D--D--F--D--S--P--H--E--D--I--

----------------------------------------------------------------------------------------------------
V--F--E--T--D--H--I--L--E--S--L--Y--R--D--I--R--D--I--Q--D--E--N--Q--L--L--V--A--D--V--K--R--L--G--K
TGTTCGAGACGGACCACATCCTGGAGTCCCTGTACCGAGACATCCGGGACATTCAGGATGAAAACCAGCTGCTGGTGGCCGACGTGAAGCGGCTGGGAAA
::::.::::::::::::::::::::.:::.:::::::::::::::.:::  :::::::::::::::::: :::: : .:.::::::::::::::::::::
TGTTTGAGACGGACCACATCCTGGAATCCTTGTACCGAGACATCCAGGAGCTTCAGGATGAAAACCAGCAGCTGTTTACTGACGTGAAGCGGCTGGGAAA
V--F--E--T--D--H--I--L--E--S--L--Y--R--D--I--Q--E--L--Q--D--E--N--Q--Q--L--F--T--D--V--K--R--L--G--K

----------------------------------------------------------------------------------------------------
--Q--N--A--R--F--L--T--S--M--R--R--L--S--S--I--K--R--D--T--N--S--I--A--K--A--I--K--A--R--G--E--V--I-
GCAGAACGCCCGCTTCCTCACGTCCATGCGGCGCCTCAGCAGCATCAAGCGCGACACCAACTCCATCGCCAAGGCCATCAAGGCCCGGGGCGAGGTCATC
:::::::::::::::::::::::::::::::::.:::::::::::::::::.::::::::::: ::.::::::: :::::::::::::::.:::. ::::
GCAGAACGCCCGCTTCCTCACGTCCATGCGGCGTCTCAGCAGCATCAAGCGTGACACCAACTCGATTGCCAAGGACATCAAGGCCCGGGGTGAGAGCATC
--Q--N--A--R--F--L--T--S--M--R--R--L--S--S--I--K--R--D--T--N--S--I--A--K--D--I--K--A--R--G--E--S--I-

----------------------------------------------------------------------------------------------------
-H--C--K--L--R--A--M--K--E--L--S--E--A--A--E--A--Q--H--G--P--H--S--A--V--A--R--I--S--R--A--Q--Y--N--
CACTGCAAGCTGCGCGCCATGAAGGAGCTGAGCGAGGCGGCTGAGGCCCAGCACGGCCCGCACTCGGCAGTGGCGCGCATTTCGCGGGCGCAGTACAACG
:::.:::::::: :::::::::::: ::::::::::: :::  ::::  :::::::.  ::::::::: :::::::::::. :::.:::::::::::.::
CACCGCAAGCTGAGCGCCATGAAGGCGCTGAGCGAGGAGGCGCAGGCAAAGCACGGTGAGCACTCGGCTGTGGCGCGCATCGCGCAGGCGCAGTACAGCG
-H--R--K--L--S--A--M--K--A--L--S--E--E--A--Q--A--K--H--G--E--H--S--A--V--A--R--I--A--Q--A--Q--Y--S--

----------------------------------------------------------------------------------------------------
A--L--T--L--T--F--Q--R--A--M--H--D--Y--N--Q--A--E--M--K--Q--R--D--N--C--K--I--R--I--Q--R--Q--L--E--I
CGCTCACCCTCACCTTCCAGCGCGCCATGCACGACTACAACCAGGCCGAGATGAAGCAGCGCGACAACTGCAAGATCCGCATCCAGCGCCAGCTGGAGAT
:::::.::: ::::::::::  .::::::::::: ::::::::::::::::::::::::::::: :::::.:::::::::::::::::::::::::::::
CGCTCGCCCGCACCTTCCAGGCTGCCATGCACGAGTACAACCAGGCCGAGATGAAGCAGCGCGAAAACTGTAAGATCCGCATCCAGCGCCAGCTGGAGAT
A--L--A--R--T--F--Q--A--A--M--H--E--Y--N--Q--A--E--M--K--Q--R--E--N--C--K--I--R--I--Q--R--Q--L--E--I

----------------------------------------------------------------------------------------------------
--M--G--K--E--V--S--G--D--Q--I--E--D--M--F--E--Q--G--K--W--D--V--F--S--E--N--L--L--A--D--V--K--G--A-
CATGGGCAAGGAAGTCTCGGGCGACCAGATCGAGGACATGTTCGAGCAGGGTAAGTGGGACGTGTTTTCCGAGAACTTGCTGGCCGACGTGAAGGGCGCG
:::::::::::: ::::::.::.::::::: ::::::::::::::.::.::.::.:::::::::::.::.::::::.:::::::.::.::::::::::::
CATGGGCAAGGACGTCTCGAGCAACCAGATAGAGGACATGTTCGAACAAGGCAAATGGGACGTGTTCTCTGAGAACCTGCTGGCTGATGTGAAGGGCGCG
--M--G--K--D--V--S--S--N--Q--I--E--D--M--F--E--Q--G--K--W--D--V--F--S--E--N--L--L--A--D--V--K--G--A-

----------------------------------------------------------------------------------------------------
-R--A--A--L--N--E--I--E--S--R--H--R--E--L--L--R--L--E--S--R--I--R--D--V--H--E--L--F--L--Q--M--A--V--
CGGGCCGCCCTCAACGAGATCGAGAGCCGCCACCGCGAACTGCTGCGCCTGGAGAGCCGCATCCGCGACGTACACGAGCTCTTCTTGCAGATGGCGGTGC
::::: :::::::::::::::::::.::::::::::::. ::::::: ::::::::::::::::::::: :.::.:: ::::::.:::::::::: .:::
CGGGCGGCCCTCAACGAGATCGAGAACCGCCACCGCGAGATGCTGCGGCTGGAGAGCCGCATCCGCGACCTGCATGACCTCTTCCTGCAGATGGCCATGC
-R--A--A--L--N--E--I--E--N--R--H--R--E--M--L--R--L--E--S--R--I--R--D--L--H--D--L--F--L--Q--M--A--M--

----------------------------------------------------------------------------------------------------
L--V--E--K--Q--A--D--T--L--N--V--I--E--L--N--V--Q--K--T--V--D--Y--T--G--Q--A--K--A--Q--V--R--K--A--V
TGGTGGAGAAGCAGGCCGACACCCTGAACGTCATCGAGCTCAACGTACAAAAGACGGTCGACTACACCGGCCAGGCCAAGGCGCAGGTGCGGAAGGCCGT
:::::::: :::::::.::::::.::.:::::::::::.:::::::.::.:::::  :.::::::::::::::::::::::.::::::::: ::::: ::
TGGTGGAGCAGCAGGCTGACACCTTGGACGTCATCGAGTTCAACGTGCAGAAGACCCTTGACTACACCGGCCAGGCCAAGGTGCAGGTGCGCAAGGCGGT
L--V--E--Q--Q--A--D--T--L--D--V--I--E--F--N--V--Q--K--T--L--D--Y--T--G--Q--A--K--V--Q--V--R--K--A--V

--------------------------------------------------------------->
--Q--Y--E--E--K--N--P--C--R--T--L--C--C--F--C--C--P--C--L--K--*-
GCAGTACGAGGAGAAGAACCCCTGCCGGACCCTCTGCTGCTTCTGCTGTCCCTGCCTCAAGTAG
:::::::.:..:::::::.:::::::::::: ::::::::::::::::.::::::::       
GCAGTACAAAAAGAAGAATCCCTGCCGGACCATCTGCTGCTTCTGCTGCCCCTGCCTG------
--Q--Y--K--K--K--N--P--C--R--T--I--C--C--F--C--C--P--C--L-------

Pig Consensus Sequence

>BGISUST0000878197
ATGAAGGACCGGCTAGTAGAACTTTTGGAGTTAACCAAGCACTATGACCAGCAGTTCCCAGAAAAGGACGATGACTTTGACTCACCTCACGAGGACATCG
TGTTTGAGACGGACCACATCCTGGAATCCTTGTACCGAGACATCCAGGAGCTTCAGGATGAAAACCAGCAGCTGTTTACTGACGTGAAGCGGCTGGGAAA
GCAGAACGCCCGCTTCCTCACGTCCATGCGGCGTCTCAGCAGCATCAAGCGTGACACCAACTCGATTGCCAAGGACATCAAGGCCCGGGGTGAGAGCATC
CACCGCAAGCTGAGCGCCATGAAGGCGCTGAGCGAGGAGGCGCAGGCAAAGCACGGTGAGCACTCGGCTGTGGCGCGCATCGCGCAGGCGCAGTACAGCG
CGCTCGCCCGCACCTTCCAGGCTGCCATGCACGAGTACAACCAGGCCGAGATGAAGCAGCGCGAAAACTGTAAGATCCGCATCCAGCGCCAGCTGGAGAT
CATGGGCAAGGACGTCTCGAGCAACCAGATAGAGGACATGTTCGAACAAGGCAAATGGGACGTGTTCTCTGAGAACCTGCTGGCTGATGTGAAGGGCGCG
CGGGCGGCCCTCAACGAGATCGAGAACCGCCACCGCGAGATGCTGCGGCTGGAGAGCCGCATCCGCGACCTGCATGACCTCTTCCTGCAGATGGCCATGC
TGGTGGAGCAGCAGGCTGACACCTTGGACGTCATCGAGTTCAACGTGCAGAAGACCCTTGACTACACCGGCCAGGCCAAGGTGCAGGTGCGCAAGGCGGT
GCAGTACAAAAAGAAGAATCCCTGCCGGACCATCTGCTGCTTCTGCTGCCCCTGCCTG---


>BGISUSP0000878197
MKDRLVELLELTKHYDQQFPEKDDDFDSPHEDIVFETDHILESLYRDIQELQDENQQLFTDVKRLGKQNARFLTSMRRLSSIKRDTNSIAKDIKARGESI
HRKLSAMKALSEEAQAKHGEHSAVARIAQAQYSALARTFQAAMHEYNQAEMKQRENCKIRIQRQLEIMGKDVSSNQIEDMFEQGKWDVFSENLLADVKGA
RAALNEIENRHREMLRLESRIRDLHDLFLQMAMLVEQQADTLDVIEFNVQKTLDYTGQAKVQVRKAVQYKKKNPCRTICCFCCPCL-