Sequences
EST Library Info
cad1Unavailable
cje2Jejunum - RNA from China
cly5Lymph - RNA from China
cst2Stomach - RNA from China
dbla1Unavailable
eje3Foetus 50 days, jejunum
gul1Gullet
jej2Small intestine, jejunum
lin2Large intestine
lnt2Lymphatic nodule tracheobroncalis
nje2Newborn 115 days, jejunum
nlu1Newborn 115 days, lung
nmm1Newborn 115 days, mucosal membranes
pgl6Pituitary gland
pigcb1Unavailable
pigcf1Unavailable
plac1Unavailable
pldo3Unavailable
pliv5Unavailable
relu1Unavailable
ret2Retina
sin2Small intestine
sme1M. Semimembranosus
spl3Spleen
ste3M. Semitendinosus
thg1Thyroid gland
tra4Trachea
uio1Unavailable
ute1Uterus
Clusters
Oligos
SNPs

Gene ID ENSG00000146278 (click for geneview)
Transcript ID ENST00000336032(link to ensembl)
Symbol PNRC1
Localtion Chromosome:6:89847216:89851598:1 band: 6q15
Description Proline-rich nuclear receptor coactivator 1 (Proline-rich protein 2) (B4-2 protein). [Source:Uniprot/SWISSPROT;Acc:Q12796]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--T--V--V--S--V--P--Q--R--E--P--L--V--L--G--G--R--L--A--P--L--G--F--S--S--R--G--Y--F--G--A--L--P--
ATGACTGTCGTCTCCGTCCCGCAGCGGGAGCCGCTCGTCCTGGGTGGCCGCCTTGCGCCGCTTGGCTTTTCCTCCCGAGGTTACTTTGGGGCCCTCCCGA
:::::.:::::.::.::::: ::::::::::::::.::.:::::..::::::: :::::  : ::::::::: :::: ::::::::.:::::::::::::
ATGACCGTCGTTTCTGTCCCCCAGCGGGAGCCGCTTGTTCTGGGCAGCCGCCTGGCGCCCATGGGCTTTTCCGCCCGCGGTTACTTCGGGGCCCTCCCGA
-M--T--V--V--S--V--P--Q--R--E--P--L--V--L--G--S--R--L--A--P--M--G--F--S--A--R--G--Y--F--G--A--L--P--

----------------------------------------------------------------------------------------------------
M--V--T--T--A--P--P--P--L--P--R--I--P--D--P--R--A--L--P--P--T--L--F--L--P--H--F--L--G--G--D--G--P--C
TGGTGACCACGGCTCCGCCTCCTTTACCCCGGATCCCGGACCCCCGGGCACTGCCCCCGACCCTCTTCCTCCCTCATTTCCTAGGGGGAGATGGCCCGTG
:::::: :::::::::::: :::::::::::::::::::::::: ::::.:::::::: ::::::::.::::::::.::..::::::::::.::.:: ::
TGGTGAGCACGGCTCCGCCGCCTTTACCCCGGATCCCGGACCCCAGGGCGCTGCCCCCCACCCTCTTTCTCCCTCACTTTTTAGGGGGAGACGGTCCCTG
M--V--S--T--A--P--P--P--L--P--R--I--P--D--P--R--A--L--P--P--T--L--F--L--P--H--F--L--G--G--D--G--P--C

----------------------------------------------------------------------------------------------------
--L--T--P--Q--P--R--A--P--A--A--L--P--N--R--S--L--A--V--A--G--G--T--P--R--A--A--P--K--K--R--R--K--K-
TCTGACCCCCCAGCCTCGCGCTCCAGCAGCTCTGCCCAACCGCAGCCTCGCCGTGGCGGGAGGCACTCCTCGGGCAGCGCCGAAGAAGCGGCGAAAGAAG
:::::::::.:::::::::::.:::::. :::::::::::.::::::::::: ...::::.:::::.::::: :::::.::.::::::::::::::::::
TCTGACCCCTCAGCCTCGCGCCCCAGCGCCTCTGCCCAACTGCAGCCTCGCCTCAACGGGGGGCACCCCTCGCGCAGCACCAAAGAAGCGGCGAAAGAAG
--L--T--P--Q--P--R--A--P--A--P--L--P--N--C--S--L--A--S--T--G--G--T--P--R--A--A--P--K--K--R--R--K--K-

----------------------------------------------------------------------------------------------------
-K--V--R--A--S--P--A--G--Q--L--P--S--R--F--H--Q--Y--Q--Q--H--R--P--S--L--E--G--G--R--S--P--A--T--G--
AAGGTGCGGGCCAGCCCCGCAGGGCAGCTGCCCAGCCGCTTCCACCAGTACCAGCAGCACCGGCCGAGTCTGGAGGGCGGCCGGAGCCCCGCGACCGGCC
:::::::::::::::::  :.:::::::: ::::::::::::::::::::::::::::::::::::::.:::::.::::  :::::::::::::: ::::
AAGGTGCGGGCCAGCCCGTCGGGGCAGCTTCCCAGCCGCTTCCACCAGTACCAGCAGCACCGGCCGAGCCTGGAAGGCGTGCGGAGCCCCGCGACGGGCC
-K--V--R--A--S--P--S--G--Q--L--P--S--R--F--H--Q--Y--Q--Q--H--R--P--S--L--E--G--V--R--S--P--A--T--G--

----------------------------------------------------------------------------------------------------
P--S--G--A--Q--E--V--P--G--P--A--A--A--L--A--P--S--P--A--A--A--A--G--T--E--G--A--S--P--D--L--A--P--L
CGAGCGGAGCGCAGGAGGTCCCGGGCCCGGCCGCCGCCTTGGCCCCGAGTCCTGCAGCCGCAGCCGGCACGGAGGGAGCCAGCCCCGACCTTGCCCCGCT
  ::.:::: :::: :.:::::::.:: ::::::::::: ::::.::. :::::::.:::::.:: : :: ::.:.::: ::::..  ::::: ::::: 
ACAGTGGAGAGCAGCAAGTCCCGGACCAGGCCGCCGCCTGGGCCTCGGCTCCTGCAACCGCAACCCGAACTGAAGAAGCGAGCCTTTTCCTTGGCCCGCG
H--S--G--E--Q--Q--V--P--D--Q--A--A--A--W--A--S--A--P--A--T--A--T--R--T--E--E--A--S--L--F--L--G--P--R

---------------------------------------><-----------------------------------------------------------
--R--P--A--A--P--G--Q--T--P--L--R--K--E--V--L--K--S--K--M--G--K--S--E--K--I--A--L--P--H--G--Q--L--V-
GCGGCCCGCGGCTCCCGGCCAAACCCCCCTCAGGAAAGAGGTTTTAAAATCAAAGATGGGAAAATCGGAGAAAATTGCCCTTCCCCATGGCCAGCTTGTT
:: ::::::::: ::::::::. ::.: .::::.:.::::::::::::::::::::::::::::::::::::::::::: :::::::.::::::::::::
GCCGCCCGCGGCGCCCGGCCAGCCCTCGTTCAGAAGAGAGGTTTTAAAATCAAAGATGGGAAAATCGGAGAAAATTGCCATTCCCCACGGCCAGCTTGTT
--P--P--A--A--P--G--Q--P--S--F--R--R--E--V--L--K--S--K--M--G--K--S--E--K--I--A--I--P--H--G--Q--L--V-

----------------------------------------------------------------------------------------------------
-H--G--I--H--L--Y--E--Q--P--K--I--N--R--Q--K--S--K--Y--N--L--P--L--T--K--I--T--S--A--K--R--N--E--N--
CATGGTATACACTTGTATGAGCAACCAAAGATAAACAGACAGAAAAGCAAATATAACTTGCCACTAACCAAGATCACCTCTGCAAAAAGAAATGAAAACA
::::::::::::::::.:::.::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::.:
CATGGTATACACTTGTGTGAACAACCAAAGATAAACAGACAGAAAAGCAAATATAACTTACCACTAACCAAGATCACCTCTGCAAAAAGAAATGAAAATA
-H--G--I--H--L--C--E--Q--P--K--I--N--R--Q--K--S--K--Y--N--L--P--L--T--K--I--T--S--A--K--R--N--E--N--

----------------------------------------------------------------------------------------------------
N--F--W--Q--D--S--V--S--S--D--R--I--Q--K--Q--E--K--K--P--F--K--N--T--E--N--I--K--N--S--H--L--K--K--S
ACTTTTGGCAGGATTCTGTTTCATCTGACAGAATTCAGAAGCAGGAAAAAAAGCCTTTTAAAAATACCGAGAACATTAAAAATTCGCATTTGAAGAAATC
::::::::::::::::::::::::::::.: ::::::::::::::::::::::::::: :::::: :.:::::::::::: ::  :::::::::::::::
ACTTTTGGCAGGATTCTGTTTCATCTGATATAATTCAGAAGCAGGAAAAAAAGCCTTTAAAAAATTCTGAGAACATTAAACATAAGCATTTGAAGAAATC
N--F--W--Q--D--S--V--S--S--D--I--I--Q--K--Q--E--K--K--P--L--K--N--S--E--N--I--K--H--K--H--L--K--K--S

----------------------------------------------------------------------------------------------------
--A--F--L--T--E--V--S--Q--K--E--N--Y--A--G--A--K--F--S--D--P--P--S--P--S--V--L--P--K--P--P--S--H--W-
AGCATTTCTAACTGAAGTGAGCCAAAAGGAAAATTATGCTGGGGCAAAGTTTAGTGATCCACCTTCTCCTAGTGTTCTTCCAAAGCCTCCTAGTCACTGG
::::::::::::::::.::::.::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::
AGCATTTCTAACTGAAATGAGTCAAAAGGAAAATTATGCTGGGGCAAAATTTAGTGATCCACCTTCTCCTAGTGTTCTTCCAAAGCCTCCTAGTCACTGG
--A--F--L--T--E--M--S--Q--K--E--N--Y--A--G--A--K--F--S--D--P--P--S--P--S--V--L--P--K--P--P--S--H--W-

----------------------------------------------------------------------------------->
-M--G--S--T--V--E--N--S--N--Q--N--R--E--L--M--A--V--H--L--K--T--L--L--K--V--Q--T--*-
ATGGGAAGCACTGTTGAAAATTCCAACCAAAACAGGGAGCTGATGGCAGTACACTTAAAAACGCTCCTCAAAGTTCAAACTTAG
:::::::::::..:::::::::::::::::::.::::::::::::::::::::::::::::: ::::: :::::::::::::::
ATGGGAAGCACCATTGAAAATTCCAACCAAAATAGGGAGCTGATGGCAGTACACTTAAAAACTCTCCTAAAAGTTCAAACTTAG
-M--G--S--T--I--E--N--S--N--Q--N--R--E--L--M--A--V--H--L--K--T--L--L--K--V--Q--T--*-

Pig Consensus Sequence

>BGISUST0000892271
ATGACCGTCGTTTCTGTCCCCCAGCGGGAGCCGCTTGTTCTGGGCAGCCGCCTGGCGCCCATGGGCTTTTCCGCCCGCGGTTACTTCGGGGCCCTCCCGA
TGGTGAGCACGGCTCCGCCGCCTTTACCCCGGATCCCGGACCCCAGGGCGCTGCCCCCCACCCTCTTTCTCCCTCACTTTTTAGGGGGAGACGGTCCCTG
TCTGACCCCTCAGCCTCGCGCCCCAGCGCCTCTGCCCAACTGCAGCCTCGCCTCAACGGGGGGCACCCCTCGCGCAGCACCAAAGAAGCGGCGAAAGAAG
AAGGTGCGGGCCAGCCCGTCGGGGCAGCTTCCCAGCCGCTTCCACCAGTACCAGCAGCACCGGCCGAGCCTGGAAGGCGTGCGGAGCCCCGCGACGGGCC
ACAGTGGAGAGCAGCAAGTCCCGGACCAGGCCGCCGCCTGGGCCTCGGCTCCTGCAACCGCAACCCGAACTGAAGAAGCGAGCCTTTTCCTTGGCCCGCG
GCCGCCCGCGGCGCCCGGCCAGCCCTCGTTCAGAAGAGAGGTTTTAAAATCAAAGATGGGAAAATCGGAGAAAATTGCCATTCCCCACGGCCAGCTTGTT
CATGGTATACACTTGTGTGAACAACCAAAGATAAACAGACAGAAAAGCAAATATAACTTACCACTAACCAAGATCACCTCTGCAAAAAGAAATGAAAATA
ACTTTTGGCAGGATTCTGTTTCATCTGATATAATTCAGAAGCAGGAAAAAAAGCCTTTAAAAAATTCTGAGAACATTAAACATAAGCATTTGAAGAAATC
AGCATTTCTAACTGAAATGAGTCAAAAGGAAAATTATGCTGGGGCAAAATTTAGTGATCCACCTTCTCCTAGTGTTCTTCCAAAGCCTCCTAGTCACTGG
ATGGGAAGCACCATTGAAAATTCCAACCAAAATAGGGAGCTGATGGCAGTACACTTAAAAACTCTCCTAAAAGTTCAAACTTAG


>BGISUSP0000892271
MTVVSVPQREPLVLGSRLAPMGFSARGYFGALPMVSTAPPPLPRIPDPRALPPTLFLPHFLGGDGPCLTPQPRAPAPLPNCSLASTGGTPRAAPKKRRKK
KVRASPSGQLPSRFHQYQQHRPSLEGVRSPATGHSGEQQVPDQAAAWASAPATATRTEEASLFLGPRPPAAPGQPSFRREVLKSKMGKSEKIAIPHGQLV
HGIHLCEQPKINRQKSKYNLPLTKITSAKRNENNFWQDSVSSDIIQKQEKKPLKNSENIKHKHLKKSAFLTEMSQKENYAGAKFSDPPSPSVLPKPPSHW
MGSTIENSNQNRELMAVHLKTLLKVQT*