Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000071537 (click for geneview)
Transcript ID ENST00000336735(link to ensembl)
Symbol SEL1L
Localtion Chromosome:14:81007646:81069886:-1 band: 14q31.1
Description Sel-1 homolog precursor (Suppressor of lin-12-like protein) (Sel-1L). [Source:Uniprot/SWISSPROT;Acc:Q9UBV2]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<--------------------------------------------------------------------><-----------------------------
-M--R--V--R--I--G--L--T--L--L--L--C--A--V--L--L--S--L--A--S--A--S--S--D--E--E--G--S--Q--D--E--S--L--
ATGCGGGTCCGGATAGGGCTGACGCTGCTGCTGTGTGCGGTGCTGCTGAGCTTGGCCTCGGCGTCCTCGGATGAAGAAGGCAGCCAGGATGAATCCTTAG
::::::::: ::.: .:::::::::::::::::::::.::::::::::.:.:.::::::::.:::.:::                               
ATGCGGGTCGGGGTCAGGCTGACGCTGCTGCTGTGTGTGGTGCTGCTGGGTTCGGCCTCGGTGTCTTCG-------------------------------
-M--R--V--G--V--R--L--T--L--L--L--C--V--V--L--L--G--S--A--S--V--S--S--------------------------------

-------><-------------------------------------------------------------------------------------------
D--S--K--T--T--L--T--S--D--E--S--V--K--D--H--T--T--A--G--R--V--V--A--G--Q--I--F--L--D--S--E--E--S--E
ATTCCAAGACTACTTTGACATCAGATGAGTCAGTAAAGGACCATACTACTGCAGGCAGAGTAGTTGCTGGTCAAATATTTCTTGATTCAGAAGAATCTGA
        ::: ::::: :::::::::::::.::::::::::::: . : .:::::::::::::::::::.::. :::::::::: ::::::::::: ::
--------ACTTCTTTGCCATCAGATGAGTCGGTAAAGGACCATAGCCCAACAGGCAGAGTAGTTGCTGGCCAGTTATTTCTTGAGTCAGAAGAATCAGA
---------T--S--L--P--S--D--E--S--V--K--D--H--S--P--T--G--R--V--V--A--G--Q--L--F--L--E--S--E--E--S--E

----------------------------------------------------------------------------------------------------
--L--E--S--S--I--Q--E--E--E--D--S--L--K--S--Q--E--G--E--S--V--T--E--D--I--S--F--L--E--S--P--N--P--E-
ATTAGAATCCTCTATTCAAGAAGAGGAAGACAGCCTCAAGAGCCAAGAGGGGGAAAGTGTCACAGAAGATATCAGCTTTCTAGAGTCTCCAAATCCAGAA
: :.::::: .:::::::::::::::::::::::::.:.:::::::::.::::::::::::.::::::: ::.:.:::::::::.:::::::::::::::
AGTGGAATCGCCTATTCAAGAAGAGGAAGACAGCCTTAGGAGCCAAGAAGGGGAAAGTGTCGCAGAAGAAATTAACTTTCTAGAATCTCCAAATCCAGAA
--V--E--S--P--I--Q--E--E--E--D--S--L--R--S--Q--E--G--E--S--V--A--E--E--I--N--F--L--E--S--P--N--P--E-

---------------------------------------><-----------------------------------------------------------
-N--K--D--Y--E--E--P--K--K--V--R--K--P--A--L--T--A--I--E--G--T--A--H--G--E--P--C--H--F--P--F--L--F--
AACAAGGACTATGAAGAGCCAAAGAAAGTACGGAAACCAGCTTTGACCGCCATTGAAGGCACAGCACATGGGGAGCCCTGCCACTTCCCTTTTCTTTTCC
::::.::::::::::::.:::: ::::::::::::::::   ::::::::::::::::::::::::::::::::::::::::::::::::::::: ::::
AACAGGGACTATGAAGAACCAACGAAAGTACGGAAACCA---TTGACCGCCATTGAAGGCACAGCACATGGGGAGCCCTGCCACTTCCCTTTTCTGTTCC
-N--R--D--Y--E--E--P--T--K--V--R--K--P-----L--T--A--I--E--G--T--A--H--G--E--P--C--H--F--P--F--L--F--

----------------------------------------------------------------------------------------------------
L--D--K--E--Y--D--E--C--T--S--D--G--R--E--D--G--R--L--W--C--A--T--T--Y--D--Y--K--A--D--E--K--W--G--F
TAGATAAGGAGTATGATGAATGTACATCAGATGGGAGGGAAGATGGCAGACTGTGGTGTGCTACAACCTATGACTACAAAGCAGATGAAAAGTGGGGCTT
:.::::::::.::.:::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::.::::::::::::::::::::
TGGATAAGGAATACGATGAATGTACATCAGATGGGAGGGAAGATGGCAGGCTGTGGTGTGCTACAACCTATGACTACAAGGCAGATGAAAAGTGGGGCTT
L--D--K--E--Y--D--E--C--T--S--D--G--R--E--D--G--R--L--W--C--A--T--T--Y--D--Y--K--A--D--E--K--W--G--F

-------><-------------------------------------------------------------------------------------------
--C--E--T--E--E--E--A--A--K--R--R--Q--M--Q--E--A--E--M--M--Y--Q--T--G--M--K--I--L--N--G--S--N--K--K-
TTGTGAAACTGAAGAAGAGGCTGCTAAGAGACGGCAGATGCAGGAAGCAGAAATGATGTATCAAACTGGAATGAAAATCCTTAATGGAAGCAATAAGAAA
:::::::                                                                                             
TTGTGAA---------------------------------------------------------------------------------------------
--C--E----------------------------------------------------------------------------------------------

-------------><-------------------------------------------------------------------------------------
-S--Q--K--R--E--A--Y--R--Y--L--Q-----K--A--A--S--M--N--H--T--K--A--L--E--R--V--S--Y--A--L--L--F--G--
AGCCAAAAAAGAGAAGCATATCGGTATCTCCAA---AAGGCAGCAAGCATGAACCATACCAAAGCCCTGGAGAGAGTGTCATATGCTCTTTTATTTGGTG
               ::::::::::::::.:::   :::::::::.::::::::::::::::.::.::::::::::::::::::::.:: ::.:::::::
---------------GCATATCGGTATCTTCAAG--AAGGCAGCAGGCATGAACCATACCAAGGCTCTGGAGAGAGTGTCATATGCCCT-TTGTTTGGTG
----------------A--Y--R--Y--L--Q--\--K--A--A--G--M--N--H--T--K--A--L--E--R--V--S--Y--A--L--L--F--G--

----------------------------------------------------------------------------------><----------------
D--Y--L--P--Q--N--I--Q--A--A--R--E--M--F--E--K--L--T--E--E--G--S--P--K--G--Q--T--A--L--G--F--L--Y--A
ATTACTTGCCACAGAATATCCAGGCAGCGAGAGAGATGTTTGAGAAGCTGACTGAGGAAGGCTCTCCCAAGGGACAGACTGCTCTTGGCTTTCTGTATGC
:::::.::.::::::::::::::::::: :.::.::::::::::::.:::::::::::::::::::::::::::::.:::                    
ATTACCTGTCACAGAATATCCAGGCAGCTAAAGGGATGTTTGAGAAACTGACTGAGGAAGGCTCTCCCAAGGGACAAACT--------------------
D--Y--L--S--Q--N--I--Q--A--A--K--G--M--F--E--K--L--T--E--E--G--S--P--K--G--Q--T---------------------

------------------------------------><----------------------------------------------------------><--
--S--G--L--G--V--N--S--S--Q--A--K--A--L--V--Y--Y--T--F--G--A--L--G--G--N--L--I--A--H--M--V--L--G--Y-
CTCTGGACTTGGTGTTAATTCAAGTCAGGCAAAGGCTCTTGTATATTATACATTTGGAGCTCTTGGGGGCAATCTAATAGCCCACATGGTTTTGGGTTAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------------------------><--------------------
-R--Y--W--A--G--I--G--V--L--Q--S--C--E--S--A--L--T--H--Y--R--L--V--A--N--H--V--A--S--D--I--S--L--T--
AGATACTGGGCTGGCATCGGCGTCCTCCAGAGTTGTGAATCTGCCCTGACTCACTATCGTCTTGTTGCCAATCATGTTGCTAGTGATATCTCGCTAACAG
                                                                              ::::::::::::::.::.::::
------------------------------------------------------------------------------GCTAGTGATATCTCACTGACAG
-------------------------------------------------------------------------------A--S--D--I--S--L--T--

----------------------------------------------------------------------------------------------------
G--G--S--V--V--Q--R--I--R--L--P--D--E--V--E--N--P--G--M--N--S--G--M--L--E--E--D--L--I--Q--Y--Y--Q--F
GAGGCTCAGTAGTACAGAGAATACGGCTGCCTGATGAAGTGGAAAATCCAGGAATGAACAGTGGAATGCTAGAAGAAGATTTGATTCAATATTACCAGTT
::::::::::::::::::::::::::::::::::.:::::.::::::::::::::::::::::::::::: :::::::::::.:::::.:::::::::::
GAGGCTCAGTAGTACAGAGAATACGGCTGCCTGACGAAGTAGAAAATCCAGGAATGAACAGTGGAATGCTCGAAGAAGATTTAATTCAGTATTACCAGTT
G--G--S--V--V--Q--R--I--R--L--P--D--E--V--E--N--P--G--M--N--S--G--M--L--E--E--D--L--I--Q--Y--Y--Q--F

---------------------------------><-------------------------------------------------------><--------
--L--A--E--K--G--D--V--Q--A--Q--V--G--L--G--Q--L--H--L--H--G--G--R--G--V--E--Q--N--H--Q--R--A--F--D-
CCTAGCTGAAAAAGGTGATGTACAAGCACAGGTTGGTCTTGGACAACTGCACCTGCACGGAGGGCGTGGAGTAGAACAGAATCATCAGAGAGCATTTGAC
:.:::::::::::::::::::::::::::::      :: :::::.:::::.:::::.:::::::::::::::::.::.:::::.:::      ::::::
CTTAGCTGAAAAAGGTGATGTACAAGCACAG------CTGGGACAGCTGCATCTGCATGGAGGGCGTGGAGTAGAGCAAAATCACCAG------TTTGAC
--L--A--E--K--G--D--V--Q--A--Q--------L--G--Q--L--H--L--H--G--G--R--G--V--E--Q--N--H--Q--------F--D-

-----------------------------------------------------------><---------------------------------------
-Y--F--N--L--A--A--N--A--G--N--S--H--A--M--A--F--L--G--K--M--Y--S--E--G--S--D--I--V--P--Q--S--N--E--
TACTTCAATTTAGCAGCAAATGCTGGCAATTCACATGCCATGGCCTTTTTGGGAAAGATGTATTCGGAAGGAAGTGACATTGTACCTCAGAGTAATGAGA
:::::::::::::::::.:::::::::::::: ::::::::::::::.:::::::::                                           
TACTTCAATTTAGCAGCGAATGCTGGCAATTCCCATGCCATGGCCTTCTTGGGAAAG-------------------------------------------
-Y--F--N--L--A--A--N--A--G--N--S--H--A--M--A--F--L--G--K--------------------------------------------

-------------------------------------><-------------------------------------------------------------
T--A--L--H--Y--F--K--K--A--A--D--M--G--N--P--V--G--Q--S--G--L--G--M--A--Y--L--Y--G--R--G--V--Q--V--N
CAGCTCTCCACTACTTTAAGAAAGCTGCTGACATGGGCAACCCAGTTGGACAGAGTGGGCTTGGAATGGCCTACCTCTATGGGAGAGGAGTTCAAGTTAA
                                   :: ::::: :::::::::::::::::.::::::::.::::::::::::::.::::::::::::  
-----------------------------------GGAAACCCTGTTGGACAGAGTGGGCTCGGAATGGCTTACCTCTATGGGAGGGGAGTTCAAGTT--
------------------------------------G--N--P--V--G--Q--S--G--L--G--M--A--Y--L--Y--G--R--G--V--Q--V---

><--------------------------------------------------------------------------------------><----------
--Y--D--L--A--L--K--Y--F--Q--K--A--A--E--Q--G--W--V--D--G--Q--L--Q--L--G--S--M--Y--Y--N--G--I--G--V-
TTATGATCTAGCCCTTAAGTATTTCCAGAAAGCTGCTGAACAAGGCTGGGTGGATGGGCAGCTACAGCTTGGTTCCATGTACTATAATGGCATTGGAGTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-K--R--D--Y--K--Q--A--L--K--Y--F--N--L--A--S--Q--G--G--H--I--L--A--F--Y--N--L--A--Q--M--H--A--S--G--
AAGAGAGATTATAAACAGGCCTTGAAGTATTTTAATTTAGCTTCTCAGGGAGGCCATATCTTGGCTTTCTATAACCTAGCTCAGATGCATGCCAGTGGCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------><-------------------------------------------------------------
T--G--V--M--R--S--C--H--T--A--V--E--L--F--K--N--V--C--E--R--G--R--W--S--E--R--L--M--T--A--Y--N--S--Y
CCGGCGTGATGCGATCATGTCACACTGCAGTGGAGTTGTTTAAGAATGTATGTGAACGAGGCCGTTGGTCTGAAAGGCTTATGACTGCCTATAACAGCTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--K--D--G--D--Y--N--A--A--V--I--Q--Y--L--L--L--A--E--Q--G--Y--E--V--A--Q--S--N--A--A--F--I--L--D--Q-
TAAAGATGGCGATTACAATGCTGCAGTGATCCAGTACCTCCTCCTGGCTGAACAGGGCTATGAAGTGGCACAAAGCAATGCAGCCTTTATTCTTGATCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---><-------------------------------------------------------------------------><--------------------
-R--E--A--S--I--V--G--E--N--E--T--Y--P--R--A--L--L--H--W--N--R--A--A--S--Q--G--Y--T--V--A--R--I--K--
AGAGAAGCAAGCATTGTAGGTGAGAATGAAACTTATCCCAGAGCTTTGCTACATTGGAACAGGGCCGCCTCTCAAGGCTATACTGTGGCTAGAATTAAGC
   ::::::: ::::::::::::::::::::: ::.::::::::::::::.::.:::::: :.:::::::: :::   ::::::::::::::::::::::
---GAAGCAACCATTGTAGGTGAGAATGAAACATACCCCAGAGCTTTGCTGCACTGGAACCGAGCCGCCTCACAA---TATACTGTGGCTAGAATTAAGC
----E--A--T--I--V--G--E--N--E--T--Y--P--R--A--L--L--H--W--N--R--A--A--S--Q-----Y--T--V--A--R--I--K--

----------------------------------------------------------------------------------------------------
L--G--D--Y--H--F--Y--G--F--G--T--D--V--D--Y--E--T--A--F--I--H--Y--R--L--A--S--E--Q--Q--H--S--A--Q--A
TCGGAGACTACCATTTCTATGGGTTTGGCACCGATGTAGATTATGAAACTGCATTTATTCATTACCGTCTGGCTTCTGAGCAGCAACACAGTGCACAAGC
:.:::::::::::::::::.:::::.:::::.:::::::::::.::.:: ::::::::::::::.:::::.:: ::::::::.::.::::::::::::::
TTGGAGACTACCATTTCTACGGGTTCGGCACTGATGTAGATTACGAGACGGCATTTATTCATTATCGTCTAGCATCTGAGCAACAGCACAGTGCACAAGC
L--G--D--Y--H--F--Y--G--F--G--T--D--V--D--Y--E--T--A--F--I--H--Y--R--L--A--S--E--Q--Q--H--S--A--Q--A

---------------------------------------------------><-----------------------------------------------
--M--F--N--L--G--Y--M--H--E--K--G--L--G--I--K--Q--D--I--H--L--A--K--R--F--Y-----D--M--A--A--E--A--S-
TATGTTTAATCTGGGATATATGCATGAGAAAGGACTGGGCATTAAACAGGATATTCACCTTGCGAAACGTTTTTAT---GACATGGCAGCTGAAGCCAGC
 ::::::::.::::::::.::::::::::::::::::::::::::::::::.:::::::::::.::::::::::::   :::::::::::.:::::::::
AATGTTTAACCTGGGATACATGCATGAGAAAGGACTGGGCATTAAACAGGACATTCACCTTGCAAAACGTTTTTATA--GACATGGCAGCCGAAGCCAGC
--M--F--N--L--G--Y--M--H--E--K--G--L--G--I--K--Q--D--I--H--L--A--K--R--F--Y--\--D--M--A--A--E--A--S-

-----------------------------------------------------------------------------------><---------------
-P--D--A--Q--V--P--V--F--L--A--L--C--K--L--G--V--V--Y--F--L--Q--Y--I--R--E--T--N--I--R--D--M--F--T--
CCAGATGCACAAGTTCCAGTCTTCCTAGCCCTCTGCAAATTGGGCGTCGTCTATTTCTTGCAGTACATACGGGAAACAAACATTCGAGATATGTTCACCC
:::::::::::.:: :::::::::::::::::::::::::::::::: ::::::::::::::::::::::::::::::   :::::::::::::::::.:
CCAGATGCACAGGTACCAGTCTTCCTAGCCCTCTGCAAATTGGGCGTGGTCTATTTCTTGCAGTACATACGGGAAACA---ATTCGAGATATGTTCACTC
-P--D--A--Q--V--P--V--F--L--A--L--C--K--L--G--V--V--Y--F--L--Q--Y--I--R--E--T-----I--R--D--M--F--T--

----------------------------------------------------------------------------------------------------
Q--L--D--M--D--Q--L--L--G--P--E--W--D--L--Y--L--M--T--I--I--A--L--L--L--G--T--V--I--A--Y--R--Q--R--Q
AACTTGATATGGACCAGCTTTTGGGACCTGAGTGGGACCTTTACCTCATGACCATCATTGCGCTGCTGTTGGGAACAGTCATAGCTTACAGGCAAAGGCA
: :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::..::::::::::::::::.::::::::::::::.:::::
ATCTTGATATGGACCAGCTTTTGGGACCTGAGTGGGACCTTTACCTCATGACCATCATTGCATTGCTGTTGGGAACAGTTATAGCTTACAGGCAGAGGCA
H--L--D--M--D--Q--L--L--G--P--E--W--D--L--Y--L--M--T--I--I--A--L--L--L--G--T--V--I--A--Y--R--Q--R--Q

-------------------------------------------------------------------------------------------
--H--Q--D--M--P--A--P--R--P--P--G--P--R--P--A--P--P--Q--Q--E--G--P--P--E--Q--Q--P--P--Q--*-
GCACCAAGACATGCCTGCACCCAGGCCTCCAGGGCCACGGCCAGCTCCACCCCAGCAGGAGGGGCCACCAGAGCAGCAGCCACCACAGTAA
:::::::::::::::::.::: ::.:::::::::::::::::::: ::::: :::::.::::::::::::::::::::: : ::.::::::
GCACCAAGACATGCCTGTACCAAGACCTCCAGGGCCACGGCCAGCACCACCACAGCAAGAGGGGCCACCAGAGCAGCAGGCTCCGCAGTAA
--H--Q--D--M--P--V--P--R--P--P--G--P--R--P--A--P--P--Q--Q--E--G--P--P--E--Q--Q--A--P--Q--*-

Pig Consensus Sequence

>BGISUST0000894745
ATGCGGGTCGGGGTCAGGCTGACGCTGCTGCTGTGTGTGGTGCTGCTGGGTTCGGCCTCGGTGTCTTCG-------------------------------
--------ACTTCTTTGCCATCAGATGAGTCGGTAAAGGACCATAGCCCAACAGGCAGAGTAGTTGCTGGCCAGTTATTTCTTGAGTCAGAAGAATCAGA
AGTGGAATCGCCTATTCAAGAAGAGGAAGACAGCCTTAGGAGCCAAGAAGGGGAAAGTGTCGCAGAAGAAATTAACTTTCTAGAATCTCCAAATCCAGAA
AACAGGGACTATGAAGAACCAACGAAAGTACGGAAACCA---TTGACCGCCATTGAAGGCACAGCACATGGGGAGCCCTGCCACTTCCCTTTTCTGTTCC
TGGATAAGGAATACGATGAATGTACATCAGATGGGAGGGAAGATGGCAGGCTGTGGTGTGCTACAACCTATGACTACAAGGCAGATGAAAAGTGGGGCTT
TTGTGAA---------------------------------------------------------------------------------------------
---------------GCATATCGGTATCTTCAaaAGGCAGCAGGCATGAACCATACCAAGGCTCTGGAGAGAGTGTCATATGCctTGTTTGGTGATTACC
TGTCACAGAATATCCAGGCAGCTAAAGGGATGTTTGAGAAACTGACTGAGGAAGGCTCTCCCAAGGGACAAACT--------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------------------------------GCTAGTGATATCTCACTGACAGGAGGCT
CAGTAGTACAGAGAATACGGCTGCCTGACGAAGTAGAAAATCCAGGAATGAACAGTGGAATGCTCGAAGAAGATTTAATTCAGTATTACCAGTTCTTAGC
TGAAAAAGGTGATGTACAAGCACAG------CTGGGACAGCTGCATCTGCATGGAGGGCGTGGAGTAGAGCAAAATCACCAG------TTTGACTACTTC
AATTTAGCAGCGAATGCTGGCAATTCCCATGCCATGGCCTTCTTGGGAAAG-------------------------------------------------
-----------------------------GGAAACCCTGTTGGACAGAGTGGGCTCGGAATGGCTTACCTCTATGGGAGGGGAGTTCAAGTT--------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------------------------------------------------------GAA
GCAACCATTGTAGGTGAGAATGAAACATACCCCAGAGCTTTGCTGCACTGGAACCGAGCCGCCTCACAA---TATACTGTGGCTAGAATTAAGCTTGGAG
ACTACCATTTCTACGGGTTCGGCACTGATGTAGATTACGAGACGGCATTTATTCATTATCGTCTAGCATCTGAGCAACAGCACAGTGCACAAGCAATGTT
TAACCTGGGATACATGCATGAGAAAGGACTGGGCATTAAACAGGACATTCACCTTGCAAAACGTTTTTAtgACATGGCAGCCGAAGCCAGCCCAGATGCA
CAGGTACCAGTCTTCCTAGCCCTCTGCAAATTGGGCGTGGTCTATTTCTTGCAGTACATACGGGAAACA---ATTCGAGATATGTTCACTCATCTTGATA
TGGACCAGCTTTTGGGACCTGAGTGGGACCTTTACCTCATGACCATCATTGCATTGCTGTTGGGAACAGTTATAGCTTACAGGCAGAGGCAGCACCAAGA
CATGCCTGTACCAAGACCTCCAGGGCCACGGCCAGCACCACCACAGCAAGAGGGGCCACCAGAGCAGCAGGCTCCGCAGTAA


>BGISUSP0000894745
MRVGVRLTLLLCVVLLGSASVSS-------------TSLPSDESVKDHSPTGRVVAGQLFLESEESEVESPIQEEEDSLRSQEGESVAEEINFLESPNPE
NRDYEEPTKVRKP-LTAIEGTAHGEPCHFPFLFLDKEYDECTSDGREDGRLWCATTYDYKADEKWGFCE-------------------------------
-----AYRYLQKAAGMNHTKALERVSYALFGDYLSQNIQAAKGMFEKLTEEGSPKGQT------------------------------------------
------------------------ASDISLTGGSVVQRIRLPDEVENPGMNSGMLEEDLIQYYQFLAEKGDVQAQ--LGQLHLHGGRGVEQNHQ--FDYF
NLAANAGNSHAMAFLGK--------------------------GNPVGQSGLGMAYLYGRGVQV------------------------------------
---------------------------------------------------------------------------------------------------E
ATIVGENETYPRALLHWNRAASQ-YTVARIKLGDYHFYGFGTDVDYETAFIHYRLASEQQHSAQAMFNLGYMHEKGLGIKQDIHLAKRFYDMAAEASPDA
QVPVFLALCKLGVVYFLQYIRET-IRDMFTHLDMDQLLGPEWDLYLMTIIALLLGTVIAYRQRQHQDMPVPRPPGPRPAPPQQEGPPEQQAPQ*