Sequences
EST Library Info
elu3Foetus 50 days, lung
pliv1Unavailable
relu2Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000115355 (click for geneview)
Transcript ID ENST00000336838(link to ensembl)
Symbol KIAA1212
Localtion Chromosome:2:55432961:55473132:-1 band: 2p16.1
Description AKT-phosphorylation enhancer [Source:RefSeq_peptide;Acc:NP_060554]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-Q--L--E--K--D--K--K--Q--L--E--K--E--N--K--R--L--R--Q--Q--A--E--I--K--D--T--T--L--E--E--N--N--V--K--
CAACTGGAAAAGGATAAGAAACAATTGGAGAAGGAAAATAAGAGACTCCGACAACAAGCAGAAATTAAAGATACCACATTAGAAGAAAATAATGTGAAGA
::.:::::::::::::::::::::.::::::::::::::::::::::::::::.::::::::::: ::::::::::::::::::::::::::::::::.:
CAGCTGGAAAAGGATAAGAAACAACTGGAGAAGGAAAATAAGAGACTCCGACAGCAAGCAGAAATAAAAGATACCACATTAGAAGAAAATAATGTGAAAA
-Q--L--E--K--D--K--K--Q--L--E--K--E--N--K--R--L--R--Q--Q--A--E--I--K--D--T--T--L--E--E--N--N--V--K--

----------------------------------------------------------------------------------------------------
I--G--N--L--E--K--E--N--K--T--L--S--K--E--I--G--I--Y--K--E--S--C--V--R--L--K--E--L--E--K--E--N--K--E
TTGGAAATTTGGAAAAAGAAAACAAAACCCTATCCAAAGAAATTGGTATATATAAAGAATCTTGTGTCCGTCTGAAAGAACTAGAAAAAGAAAATAAGGA
::::::::::.:::::::::::::::.:::: :.::::::.:::::::: :::::::::::.::..:.:::::.::.:::.::::.::::::::::::::
TTGGAAATTTAGAAAAAGAAAACAAAGCCCTTTTCAAAGAGATTGGTATTTATAAAGAATCCTGCATTCGTCTAAAGGAATTAGAGAAAGAAAATAAGGA
I--G--N--L--E--K--E--N--K--A--L--F--K--E--I--G--I--Y--K--E--S--C--I--R--L--K--E--L--E--K--E--N--K--E

---------------------------------------------------><-----------------------------------------------
--L--V--K--R--A--T--I--D--I--K--T--L--V--T--L--R--E--D--L--V--S--E--K--L--K--T--Q--Q--M--N--N--D--L-
GCTTGTGAAAAGAGCAACTATTGATATAAAAACGTTGGTTACACTACGTGAGGATTTGGTGAGTGAAAAGTTGAAGACCCAACAGATGAACAATGATCTC
::::::::::::::::::::::::::::::::: :::::::::.:::: ::::::::::: ::::::::.::::::::.:::::.:::::.::::::::.
GCTTGTGAAAAGAGCAACTATTGATATAAAAACTTTGGTTACATTACGAGAGGATTTGGTCAGTGAAAAATTGAAGACTCAACAAATGAATAATGATCTT
--L--V--K--R--A--T--I--D--I--K--T--L--V--T--L--R--E--D--L--V--S--E--K--L--K--T--Q--Q--M--N--N--D--L-

-------------------------------------------------------------------------------><-------------------
-E--K--L--T--H--E--L--E--K--I--G--L--N--K--E--R--L--L--H--D--E--Q--S--T--D--D--S--R--Y--K--L--L--E--
GAAAAATTAACTCATGAGCTTGAGAAGATAGGGTTAAATAAGGAGCGACTCTTACATGATGAACAAAGTACTGATGACAGTAGGTATAAACTTTTGGAAT
:::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::.:::::::::::::::   :::::.:::::::::::::
GAAAAATTAACTCATGAGCTTGAGAAGATAGGGTTAAATAAAGAGCGACTCTTACATGATGAGCAAAGTACTGATGAC---AGGTACAAACTTTTGGAAT
-E--K--L--T--H--E--L--E--K--I--G--L--N--K--E--R--L--L--H--D--E--Q--S--T--D--D-----R--Y--K--L--L--E--

----------------------------------------------------------------------------------------------------
S--K--L--E--S--T--L--K--K--S--L--E--I--K--E--E--K--I--A--A--L--E--A--R--L--E--E--S--T--N--Y--N--Q--Q
CAAAATTAGAATCCACTCTTAAGAAGTCTCTTGAAATAAAAGAAGAAAAAATTGCTGCTTTAGAAGCTCGATTAGAAGAATCCACGAATTATAACCAGCA
:::::::::::::.::::: ::::::::.:::::::::::::::::::::::::::::.::::::::::::::::::::::::::.::::::::::::::
CAAAATTAGAATCTACTCTAAAGAAGTCCCTTGAAATAAAAGAAGAAAAAATTGCTGCCTTAGAAGCTCGATTAGAAGAATCCACAAATTATAACCAGCA
S--K--L--E--S--T--L--K--K--S--L--E--I--K--E--E--K--I--A--A--L--E--A--R--L--E--E--S--T--N--Y--N--Q--Q

---------------------><-----------------------------------------------------------------------------
--L--R--Q--E--L--K--T--V--K--K--N--Y--E--A--L--K--Q--R--Q--D--E--E--R--M--V--Q--S--S--P--P--I--S--G-
ATTGCGCCAAGAACTTAAAACAGTGAAAAAAAATTATGAAGCTCTCAAACAGAGACAAGATGAGGAAAGGATGGTACAGAGCTCTCCTCCAATATCTGGT
::::::::::::::::::::::::::::::.:::::::::::::::::::::::.::.:::::::::::.::::::::::::::::::::::. ::::::
ATTGCGCCAAGAACTTAAAACAGTGAAAAAGAATTATGAAGCTCTCAAACAGAGGCAGGATGAGGAAAGAATGGTACAGAGCTCTCCTCCAACTTCTGGT
--L--R--Q--E--L--K--T--V--K--K--N--Y--E--A--L--K--Q--R--Q--D--E--E--R--M--V--Q--S--S--P--P--T--S--G-

--------------------------------------------------------------------------------------><------------
-E--D--N--K--W--E--R--E--S--Q--E--T--T--R--E--L--L--K--V--K--D--R--L--I--E--V--E--R--N--N--A--T--L--
GAAGACAACAAATGGGAGCGAGAAAGTCAAGAAACGACTAGAGAACTTCTGAAAGTTAAAGACAGATTAATTGAAGTAGAAAGAAATAATGCTACACTGC
:::::.::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::.::::::::::::::::::::::
GAAGATAACAAATGGGAGCGAGAAAGTCAAGAAACGACTAGAGAGCTTCTGAAAGTTAAAGACAGATTAATTGAAGTGGAAAGAAATAATGCTACACTGC
-E--D--N--K--W--E--R--E--S--Q--E--T--T--R--E--L--L--K--V--K--D--R--L--I--E--V--E--R--N--N--A--T--L--

----------------------------------------------------------------------------------------------------
Q--A--E--K--Q--A--L--K--T--Q--L--K--Q--L--E--T--Q--N--N--N--L--Q--A--Q--I--L--A--L--Q--R--Q--T--V--S
AAGCAGAGAAGCAAGCGTTGAAAACTCAACTGAAGCAACTTGAGACACAGAACAATAATTTGCAGGCTCAGATTCTTGCACTTCAGAGGCAGACAGTGTC
::::::::::::::::..::::::::::::::::.  ::::                                                           
AAGCAGAGAAGCAAGCACTGAAAACTCAACTGAAAGCACTT-----------------------------------------------------------
Q--A--E--K--Q--A--L--K--T--Q--L--K--A--L------------------------------------------------------------

------------------------------------------------><--------------------------------------------------
--L--Q--E--Q--N--T--T--L--Q--T--Q--N--A--K--L--Q--V--E--N--S--T--L--N--S--Q--S--T--S--L--M--N--Q--N-
ATTACAAGAACAGAATACCACTCTTCAAACACAGAATGCCAAGCTTCAGGTTGAAAATTCCACCCTTAATTCCCAAAGTACCTCACTCATGAACCAGAAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-A--Q--L--L--I--Q--Q--S--S--L--E--N--E--N--E--S--V--I--K--E--R--E--D--L--K--S--L--Y--D--S--L--I--K--
GCCCAACTCCTAATCCAGCAGTCTTCCTTAGAAAATGAAAATGAATCTGTAATCAAAGAGCGAGAAGACCTAAAATCTCTCTATGATTCTCTGATCAAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
D--H--E--K--L--E--L--L--H--E--R--Q--A--S--E--Y--E--S--L--I--S--K--H--G--T--L--K--S--A--H--K--N--L--E
ATCATGAAAAGCTGGAACTTCTTCATGAACGTCAGGCTTCAGAGTATGAATCTCTTATCTCTAAACATGGAACTCTGAAGTCTGCCCACAAAAATCTTGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------><------------------------------------------------------------------------
--V--E--H--R--D--L--E--D--R--Y--N--Q--L--L--K--Q--K--G--Q--L--E--D--L--E--K--M--L--K--V--E--Q--E--K-
GGTGGAACATAGAGACCTTGAAGACCGTTACAATCAGTTATTAAAACAGAAAGGACAGTTGGAAGATTTGGAAAAAATGCTCAAAGTAGAACAGGAAAAA
                            :::::::::::::::::::::::::::::.::::::::::::::::: :..:::::::::::::::::::::
----------------------------TACAATCAGTTATTAAAACAGAAAGGACAATTGGAAGATTTGGAAAATACACTCAAAGTAGAACAGGAAAAA
-----------------------------Y--N--Q--L--L--K--Q--K--G--Q--L--E--D--L--E--N--T--L--K--V--E--Q--E--K-

----------------------------------------------------------------------><----------------------------
-M--L--L--E--N--K--N--H--E--T--V--A--A--E--Y--K--K--L--C--G--E--N--D--R--L--N--H--T--Y--S--Q--L--L--
ATGCTGCTTGAAAATAAAAATCATGAAACAGTAGCTGCAGAATACAAGAAACTTTGTGGTGAAAATGATAGGCTGAATCATACCTATAGTCAACTTTTAA
:::::::::.:::..:::::.:::::.:: :::::::: ::::::::::::::::::::::::::::::   .:::::::::: ::::..::.:::::::
ATGCTGCTTAAAAGCAAAAACCATGAGACTGTAGCTGCTGAATACAAGAAACTTTGTGGTGAAAATGAT---TTGAATCATACATATAACCAGCTTTTAA
-M--L--L--K--S--K--N--H--E--T--V--A--A--E--Y--K--K--L--C--G--E--N--D-----L--N--H--T--Y--N--Q--L--L--

----------------------------------------------------------------------------------------------------
K--E--T--E--V--L--Q--T--D--H--K--N--L--K--S--L--L--N--N--S--K--L--E--Q--T--R--L--E--A--E--F--S--K--L
AAGAGACTGAAGTTTTACAAACTGACCATAAAAATTTGAAAAGTCTTCTGAATAATTCCAAACTGGAACAAACAAGATTAGAAGCTGAATTTTCAAAACT
::::::::::::::::::::::::::::::::::.::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::..:
AAGAGACTGAAGTTTTACAAACTGACCATAAAAACTTGAAAAGTCTTCTAAATAATTCCAAACTGGAACAAACAAGATTAGAAGCTGAATTTTCAAAGTT
K--E--T--E--V--L--Q--T--D--H--K--N--L--K--S--L--L--N--N--S--K--L--E--Q--T--R--L--E--A--E--F--S--K--L

---------------------------------------------------------><-----------------------------------------
--K--E--Q--Y--Q--Q--L--D--I--T--S--T--K--L--N--N--Q--C--E--L--L--S--Q--L--K--G--N--L--E--E--E--N--R-
AAAGGAACAATACCAACAATTGGATATTACATCAACCAAGCTGAATAACCAGTGTGAGTTGCTAAGCCAACTTAAAGGAAATTTAGAAGAAGAAAATCGG
:::::::::.::::::::.:::::.::.::::: ::::::::.:::::::::::::::                                          
AAAGGAACAGTACCAACAGTTGGACATCACATCCACCAAGCTAAATAACCAGTGTGAG------------------------------------------
--K--E--Q--Y--Q--Q--L--D--I--T--S--T--K--L--N--N--Q--C--E-------------------------------------------

----------------------------------------------------------------------------------------------------
-H--L--L--D--Q--I--Q--T--L--M--L--Q--N--R--T--L--L--E--Q--N--M--E--S--K--D--L--F--H--V--E--Q--R--Q--
CATCTACTAGATCAAATTCAGACATTAATGCTACAGAACAGAACACTTTTGGAGCAGAATATGGAAAGCAAGGATCTTTTTCATGTTGAACAAAGACAGT
            ::::::::::::::::::::::::::::::::::: :::::::::::::::::::::::::::::.::::::::::::::::::::::
------------CAAATTCAGACATTAATGCTACAGAACAGAACACTATTGGAGCAGAATATGGAAAGCAAGGATCTCTTTCATGTTGAACAAAGACAGT
-------------Q--I--Q--T--L--M--L--Q--N--R--T--L--L--E--Q--N--M--E--S--K--D--L--F--H--V--E--Q--R--Q--

---><-------------------------------------------------------------------------------------------><--
Y--I--D--K--L--N--E--L--R--R--Q--K--E--K--L--E--E--K--I--M--D--Q--Y--K--F--Y--D--P--S--P--P--R--R--R
ACATTGATAAGTTAAATGAATTAAGACGTCAGAAGGAGAAACTAGAAGAGAAAATTATGGATCAATACAAATTTTATGACCCATCTCCTCCTAGAAGGAG
::   ::::::::::::::::::::::: ::.:::::::::.:: :::::::::::::::::::::::::::::::::::::::::::::: :::   ::
AC---GATAAGTTAAATGAATTAAGACGACAAAAGGAGAAATTACAAGAGAAAATTATGGATCAATACAAATTTTATGACCCATCTCCTCCGAGA---AG
Y-----D--K--L--N--E--L--R--R--Q--K--E--K--L--Q--E--K--I--M--D--Q--Y--K--F--Y--D--P--S--P--P--R-----R

----------------------------------------------------------------------------------------------------
--G--N--W--I--T--L--K--M--R--K--L--I--K--S--K--K--D--I--N--R--E--R--Q--K--S--L--T--L--T--P--T--R--S-
AGGCAACTGGATTACTCTAAAAATGAGAAAATTGATAAAGTCTAAGAAAGATATTAATCGGGAACGCCAGAAATCTCTAACATTAACACCCACCCGCTCA
::::::::::::.::::::::::::::::::::::::::::::::.:::::..:::::::.:::::.:::::::: ::.::::::::::: :::::::::
AGGCAACTGGATCACTCTAAAAATGAGAAAATTGATAAAGTCTAAAAAAGACGTTAATCGAGAACGTCAGAAATCACTGACATTAACACCAACCCGCTCA
--G--N--W--I--T--L--K--M--R--K--L--I--K--S--K--K--D--V--N--R--E--R--Q--K--S--L--T--L--T--P--T--R--S-

----------------------------------------------------------------------------------------------------
-D--S--S--E--G--F--L--Q--L--P--H--Q--D--S--Q--D--S--S--S--V--G--S--N--S--L--E--D--G--Q--T--L--G--T--
GACTCCAGTGAAGGATTTCTTCAGCTCCCTCATCAAGACAGTCAAGATAGTTCTTCAGTAGGTTCAAACTCTTTAGAAGATGGCCAGACCTTGGGGACCA
 ::::::::::::::::::::::.:::::.:::::::::::::::::::::::::::.::::::::::.::::::.::::::::::.::.::::::::::
CACTCCAGTGAAGGATTTCTTCAACTCCCCCATCAAGACAGTCAAGATAGTTCTTCAATAGGTTCAAATTCTTTAAAAGATGGCCAAACTTTGGGGACCA
-H--S--S--E--G--F--L--Q--L--P--H--Q--D--S--Q--D--S--S--S--I--G--S--N--S--L--K--D--G--Q--T--L--G--T--

-----------><----------------------------------------------------------------------------------><---
K--K--S--S--M--V--A--L--K--R--L--P--F--L--R--N--R--P--K--D--K--D--K--M--K--A--C--Y--R--R--S--M--S--M
AGAAAAGCAGCATGGTTGCACTGAAAAGACTGCCCTTTTTGAGGAACAGACCGAAGGATAAAGACAAAATGAAGGCCTGCTACCGTCGTTCCATGTCCAT
::::::::      :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::   ::
AGAAAAGC------GTTGCACTGAAAAGACTGCCCTTTTTGAGGAACAGACCGAAGGATAAAGACAAAATGAAGGCCTGCTACCGTCGTTCCATG---AT
K--K--S--------V--A--L--K--R--L--P--F--L--R--N--R--P--K--D--K--D--K--M--K--A--C--Y--R--R--S--M-----M

----------------------------------------------------------------------------------------------------
--N--D--L--V--Q--S--M--V--L--A--G-----Q--W--T--G--S--T--E--N--L--E--V--P--D--D--I--S--T--G--K--R--R-
GAATGACCTGGTGCAGTCCATGGTCCTAGCAGGA---CAGTGGACAGGTAGTACTGAGAATTTGGAGGTTCCTGATGATATTTCAACGGGTAAAAGGAGA
::::::::::::::::::::::::::::::::::   :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GAATGACCTGGTGCAGTCCATGGTCCTAGCAGGAGGACAGTGGACAGGTAGTACTGAGAATTTGGAGGTTCCTGATGATATTTCAACGGGTAAAAGGAGA
--N--D--L--V--Q--S--M--V--L--A--G--G--Q--W--T--G--S--T--E--N--L--E--V--P--D--D--I--S--T--G--K--R--R-

--------------------------------------------------------------------------------------------------->
-K--E--L--G--A--M--A--F--S--T--T--A--I--N--F--S--T--V--N--S--S--A--G--F--R--S--K--Q--L--V--N--N--K--
AAAGAATTGGGAGCTATGGCCTTCTCTACTACAGCCATCAACTTTTCAACTGTCAACTCTTCTGCAGGCTTCAGATCCAAGCAGTTGGTTAATAATAAAG
::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::.::::::::::::::::::::::::::::::::::: 
AAAGAATTGGGAGCTATGGCCTTCTCTACTACAGCCATCAACTTTTCAGCTGTCAACTCTTCTACAGGCTTCAGATCCAAGCAGTTGGTTAATAATAAA-
-K--E--L--G--A--M--A--F--S--T--T--A--I--N--F--S--A--V--N--S--S--T--G--F--R--S--K--Q--L--V--N--N--K--

<----------------------------------------------------------------------><---------------------------
D--T--T--S--F--E--D--I--S--P--Q--G--V--S--D--D--S--S--T--G--S--R--V--H--A--S--R--P--A--S--L--D--S--G
ATACTACATCCTTTGAAGACATAAGTCCACAAGGTGTTAGTGATGATTCTAGTACGGGATCAAGAGTTCATGCTTCAAGACCAGCCAGCCTTGATAGTGG
  ::::::::::::::::::.::::::::::::::.:::::::::::::::::::::::::::::::::::   ::.:::::::::::::::::::::::
--ACTACATCCTTTGAAGACGTAAGTCCACAAGGTATTAGTGATGATTCTAGTACGGGATCAAGAGTTCAT---TCGAGACCAGCCAGCCTTGATAGTGG
---T--T--S--F--E--D--V--S--P--Q--G--I--S--D--D--S--S--T--G--S--R--V--H-----S--R--P--A--S--L--D--S--G

----------------------------------------------------><----------------------------------------------
--R--T--S--T--S--N--S--N--N--N--A--S--L--H--E--V--K--A--G--A--V--N--N--Q--S--R--P--Q--S--H--S--S--G-
CAGAACATCCACTAGCAATAGCAATAATAATGCTTCACTACATGAAGTCAAAGCAGGTGCAGTTAATAACCAAAGCAGGCCACAAAGCCACAGCAGTGGA
::::::::::::::::::::::::::::::::::::::: ::::::::::::   ::::::::::::: :::::::::::::::::::::::::::::::
CAGAACATCCACTAGCAATAGCAATAATAATGCTTCACTCCATGAAGTCAAA---GGTGCAGTTAATATCCAAAGCAGGCCACAAAGCCACAGCAGTGGA
--R--T--S--T--S--N--S--N--N--N--A--S--L--H--E--V--K-----G--A--V--N--I--Q--S--R--P--Q--S--H--S--S--G-

----------------------------------------------------------------------------------------------------
-E--F--S--L--L--H--D--H--E--A--W--S--S--S--G--S--S--P--I--Q--Y--L--K--R--Q--T--R--S--S--P-----V--L--
GAATTTAGCCTGCTTCATGACCATGAGGCTTGGTCCAGCAGTGGTAGCAGTCCAATCCAGTACTTGAAAAGACAGACCAGATCAAGCCCA---GTGCTCC
:::::::::::::::::::: :::::.::.::::::::::::::::::::::::::::::::::::::::::::.:::::::::::.:::   :::::::
GAATTTAGCCTGCTTCATGAGCATGAAGCCTGGTCCAGCAGTGGTAGCAGTCCAATCCAGTACTTGAAAAGACAAACCAGATCAAGTCCAG--GTGCTCC
-E--F--S--L--L--H--E--H--E--A--W--S--S--S--G--S--S--P--I--Q--Y--L--K--R--Q--T--R--S--S--P--\--V--L--

----------------------------------------------------------------------------------------------------
Q--H--K--I--S--E--T--L--E--S--R-----H--H--K--I--K--T--G--S--P--G--S--E--V--V--T--L--Q--Q--F--L--E--E
AGCACAAAATATCTGAAACACTGGAGAGTCGA---CATCACAAGATCAAAACTGGTTCCCCTGGAAGTGAAGTTGTTACTCTACAACAGTTTTTGGAAGA
::::::::         :::::.:::::::::   ::::.::::::::::: ::::::::::::::::::::::::::::::::::::::::::::::::
AGCACAAA---------ACACTAGAGAGTCGAGCACATCGCAAGATCAAAAGTGGTTCCCCTGGAAGTGAAGTTGTTACTCTACAACAGTTTTTGGAAGA
Q--H--K-----------T--L--E--S--R--A--H--R--K--I--K--S--G--S--P--G--S--E--V--V--T--L--Q--Q--F--L--E--E

------------------------><--------------------------------------------------------------------------
--S--N--K--L--T--S--V--Q--I--K--S--S--S--Q--E--N--L--L--D--E--V--M--K--S--L--S--V--S--S--D--F--L--G-
AAGCAATAAGCTTACCTCAGTACAGATAAAGTCCTCAAGTCAAGAGAATCTTTTAGATGAAGTAATGAAAAGTTTGTCTGTCTCTTCTGACTTTTTGGGA
::::::.::::::::::::.:::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::::
AAGCAACAAGCTTACCTCAATACAGATAAAGCCCTCAAGTCAAGAGAATCTTTTAGATGAAGTAATGAAAAGTTTGTCTGTATCTTCTGACTTTTTGGGA
--S--N--K--L--T--S--I--Q--I--K--P--S--S--Q--E--N--L--L--D--E--V--M--K--S--L--S--V--S--S--D--F--L--G-

----------------------------------------------------------------------------------------------------
-K--D--K--P--V--S--C--G--L--A--R--S--V--S--G--K--T--P--G--D--F--Y--D--R--R--T--T--K--P--E-----F--L--
AAAGACAAACCAGTTAGCTGTGGTCTGGCCAGGTCAGTAAGTGGAAAAACCCCAGGGGACTTCTATGATAGACGGACAACTAAGCCTGAG---TTTTTGA
:::.::::::::::::::::::::::::::::::::::::::::::::::.:: ::.:::::::::::.::::::::::::::::::::.   ::: :::
AAAAACAAACCAGTTAGCTGTGGTCTGGCCAGGTCAGTAAGTGGAAAAACTCCTGGAGACTTCTATGACAGACGGACAACTAAGCCTGAACAGTTTGTGA
-K--N--K--P--V--S--C--G--L--A--R--S--V--S--G--K--T--P--G--D--F--Y--D--R--R--T--T--K--P--E--Q--F--V--

----------------------------------------------------------------------------------------------------
R--P--G--P--R--K--T--E--D--T--Y--F--I--S--S--A--G--K--P--T--P--G--T--Q--G--K--I--K--L--V--K--E--S--S
GACCTGGTCCTCGAAAAACTGAAGATACCTACTTCATTAGTTCTGCGGGAAAACCTACACCAGGCACTCAAGGAAAAATAAAATTAGTAAAAGAATCTTC
::::::::::::.:::.::::::::::::::.:::::::::::: :.:::::..::::::.:::::::::::::::.:::::.:::::::::::: ::::
GACCTGGTCCTCAAAAGACTGAAGATACCTATTTCATTAGTTCTTCAGGAAAGTCTACACTAGGCACTCAAGGAAAGATAAAGTTAGTAAAAGAAACTTC
R--P--G--P--Q--K--T--E--D--T--Y--F--I--S--S--S--G--K--S--T--L--G--T--Q--G--K--I--K--L--V--K--E--T--S

----------------------------------------------------------------------------------------------------
--L--S--R--Q--S--K--D--S--N--P--Y--A--T--L--P--R--A--S--S--V--I--S--T--A--E--G--T--T--R--R--T--S--I-
TCTGTCACGACAATCAAAAGATAGTAACCCTTATGCAACTTTACCTCGTGCAAGCAGCGTGATCTCAACTGCCGAAGGAACTACACGAAGGACAAGCATC
:::::::::::::::::::::::::::.:::::::: ::::::::::::::::::::.:::::::: ::::::::::::::::: :::::::::::.:::
TCTGTCACGACAATCAAAAGATAGTAATCCTTATGCCACTTTACCTCGTGCAAGCAGTGTGATCTCTACTGCCGAAGGAACTACTCGAAGGACAAGTATC
--L--S--R--Q--S--K--D--S--N--P--Y--A--T--L--P--R--A--S--S--V--I--S--T--A--E--G--T--T--R--R--T--S--I-

----------------------------------------------------------------------------------------------------
-H--D--F--L--T--K--D--S--R--L--P--I--S--V--D--S--P--P--A--A--A--D--S--N--T--T--A--A--S--S--E--Y--H--
CATGATTTTTTGACCAAGGACAGTAGACTGCCTATATCAGTTGATTCACCACCAGCTGCTGCTGACAGCAACACCACTGCAGCATCTAGTGAGTACCATT
:::::::::::::: ::.:::::::::::.:::::.:::::::::::::::::::::.:::::::.::::.::.::::::::::::::::::::::::::
CATGATTTTTTGACAAAAGACAGTAGACTACCTATGTCAGTTGATTCACCACCAGCTACTGCTGATAGCAGCATCACTGCAGCATCTAGTGAGTACCATT
-H--D--F--L--T--K--D--S--R--L--P--M--S--V--D--S--P--P--A--T--A--D--S--S--I--T--A--A--S--S--E--Y--H--

----------------------------------------------------------------------------------------------------
L--H--Q--W--S--S--H--I--L--D--I--P--T--H--T--I--G--S--C--A--Q--N--D--L--A--I--D--M--P--E--P--L--Y--A
TACACCAGTGGTCCTCTCATATACTTGACATCCCAACACATACTATAGGTTCTTGTGCCCAAAATGATTTAGCTATAGACATGCCTGAGCCTCTATATGC
::.::: ::::::::::::::.:::: ::. .:::.::.:: ::.::::.:::.. :: ::::::.:::::: ::.::::: :::..::.:::.::::::
TATACCCGTGGTCCTCTCATACACTTCACGGTCCAGCATATCCTGTAGGCTCTCAAGCACAAAATAATTTAGGTACAGACAAGCCCAAGTCTCCATATGC
L--Y--P--W--S--S--H--T--L--H--G--P--A--Y--P--V--G--S--Q--A--Q--N--N--L--G--T--D--K--P--K--S--P--Y--A

----------------------------------------------------------------------------------------------------
--Q--A--R--N--S--R--T--G--R--S--H--F-----L--N--Q--T--F--A--T--I--R--M--P--S--D--A--F--G--M--L--A--K-
CCAGGCTAGAAACTCAAGAACAGGAAGGTCACATTTT---CTAAACCAAACTTTTGCCACTATTAGGATGCCTAGTGATGCATTCGGAATGTTGGCAAAA
::::.:.:::::::.::::.:::.::.::::.:::::   :::::::::::::::::::::: ::. :::..::.:::::::.:.:::::.:..:: :::
CCAGACCAGAAACTTAAGAGCAGAAAAGTCATATTTTC--CTAAACCAAACTTTTGCCACTAGTAATATGTTTAATGATGCACTTGGAATATCAGCTAAA
--Q--T--R--N--L--R--A--E--K--S--Y--F--\--L--N--Q--T--F--A--T--S--N--M--F--N--D--A--L--G--I--S--A--K-

----------------------------------------------------------------------------------------------------
-D--S--I--G--P--F--T--V--A--H--S--S--Q--P--F--L--S--L--N--T--E--L--V--S--N--I--S--G--L--P--P--R--P--
GATAGCATAGGACCATTTACTGTGGCCCATTCATCTCAGCCATTCTTATCCCTGAATACAGAATTAGTTAGTAACATAAGTGGGTTACCTCCTAGGCCAG
::.::: :::...: :::::::::::..::.:::::::::::::.:::::.::.::::::::::::::.:::::::::::::::::.:::::.::..:::
GACAGCTTAGAGTCCTTTACTGTGGCTTATCCATCTCAGCCATTTTTATCTCTAAATACAGAATTAGTCAGTAACATAAGTGGGTTGCCTCCCAGATCAG
-D--S--L--E--S--F--T--V--A--Y--P--S--Q--P--F--L--S--L--N--T--E--L--V--S--N--I--S--G--L--P--P--R--S--

----------------------------------------------------------------------------------------------------
V--I--R--I--T--D--Q--A--S--A--S--L--D--K--P--A--Q--K--E--N--E--Q--F--S--D--H--Q--N--P--S--N--S--N--L
TTATCAGAATAACTGACCAGGCTTCTGCCTCTTTGGATAAACCTGCACAGAAAGAAAATGAACAGTTTTCTGATCATCAGAACCCTAGTAACAGTAACCT
:.:.::::.:::.:::::::::::::::.:::::::::::: :::.::.::::.: ::.::.::::::: :::: .:::::::. ::::::.::::::..
TCACCAGAGTAATTGACCAGGCTTCTGCTTCTTTGGATAAAGCTGTACGGAAAAATAACGAGCAGTTTTATGATAGTCAGAACTGTAGTAATAGTAACTC
V--T--R--V--I--D--Q--A--S--A--S--L--D--K--A--V--R--K--N--N--E--Q--F--Y--D--S--Q--N--C--S--N--S--N--S

----------------------------------------------------------------------------------------------------
--Q--F--S--I--N--S--N--N--L--V--T--S--A--C--L--Y--P--D--D--T--E--A--A--L--L--V--S--E--D--N--Q--T--V-
ACAGTTTTCTATAAATAGCAACAATCTTGTCACTTCTGCATGCCTCTATCCTGATGACACAGAAGCTGCATTGTTGGTTTCTGAGGATAATCAAACTGTT
:::::.::::.::.::::::...:::::.:::::.:::::::.:.:::::::.: :::::::::.:.:::::::::::::::::::::::::::::::::
ACAGTCTTCTGTAGATAGCAGTGATCTTATCACTCCTGCATGTCCCTATCCTAAGGACACAGAAACCGCATTGTTGGTTTCTGAGGATAATCAAACTGTT
--Q--S--S--V--D--S--S--D--L--I--T--P--A--C--P--Y--P--K--D--T--E--T--A--L--L--V--S--E--D--N--Q--T--V-

----------------------->
-W--Y--E--Y--G--C--I--*-
TGGTATGAATATGGTTGTATATGA
::::::::.:::::::::.:::::
TGGTATGAGTATGGTTGTGTATGA
-W--Y--E--Y--G--C--V--*-

Pig Consensus Sequence

>BGISUST0000896090
CAGCTGGAAAAGGATAAGAAACAACTGGAGAAGGAAAATAAGAGACTCCGACAGCAAGCAGAAATAAAAGATACCACATTAGAAGAAAATAATGTGAAAA
TTGGAAATTTAGAAAAAGAAAACAAAGCCCTTTTCAAAGAGATTGGTATTTATAAAGAATCCTGCATTCGTCTAAAGGAATTAGAGAAAGAAAATAAGGA
GCTTGTGAAAAGAGCAACTATTGATATAAAAACTTTGGTTACATTACGAGAGGATTTGGTCAGTGAAAAATTGAAGACTCAACAAATGAATAATGATCTT
GAAAAATTAACTCATGAGCTTGAGAAGATAGGGTTAAATAAAGAGCGACTCTTACATGATGAGCAAAGTACTGATGAC---AGGTACAAACTTTTGGAAT
CAAAATTAGAATCTACTCTAAAGAAGTCCCTTGAAATAAAAGAAGAAAAAATTGCTGCCTTAGAAGCTCGATTAGAAGAATCCACAAATTATAACCAGCA
ATTGCGCCAAGAACTTAAAACAGTGAAAAAGAATTATGAAGCTCTCAAACAGAGGCAGGATGAGGAAAGAATGGTACAGAGCTCTCCTCCAACTTCTGGT
GAAGATAACAAATGGGAGCGAGAAAGTCAAGAAACGACTAGAGAGCTTCTGAAAGTTAAAGACAGATTAATTGAAGTGGAAAGAAATAATGCTACACTGC
AAGCAGAGAAGCAAGCACTGAAAACTCAACTGAAAGCACTT-----------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------TACAATCAGTTATTAAAACAGAAAGGACAATTGGAAGATTTGGAAAATACACTCAAAGTAGAACAGGAAAAA
ATGCTGCTTAAAAGCAAAAACCATGAGACTGTAGCTGCTGAATACAAGAAACTTTGTGGTGAAAATGAT---TTGAATCATACATATAACCAGCTTTTAA
AAGAGACTGAAGTTTTACAAACTGACCATAAAAACTTGAAAAGTCTTCTAAATAATTCCAAACTGGAACAAACAAGATTAGAAGCTGAATTTTCAAAGTT
AAAGGAACAGTACCAACAGTTGGACATCACATCCACCAAGCTAAATAACCAGTGTGAG------------------------------------------
------------CAAATTCAGACATTAATGCTACAGAACAGAACACTATTGGAGCAGAATATGGAAAGCAAGGATCTCTTTCATGTTGAACAAAGACAGT
AC---GATAAGTTAAATGAATTAAGACGACAAAAGGAGAAATTACAAGAGAAAATTATGGATCAATACAAATTTTATGACCCATCTCCTCCGAGA---AG
AGGCAACTGGATCACTCTAAAAATGAGAAAATTGATAAAGTCTAAAAAAGACGTTAATCGAGAACGTCAGAAATCACTGACATTAACACCAACCCGCTCA
CACTCCAGTGAAGGATTTCTTCAACTCCCCCATCAAGACAGTCAAGATAGTTCTTCAATAGGTTCAAATTCTTTAAAAGATGGCCAAACTTTGGGGACCA
AGAAAAGC------GTTGCACTGAAAAGACTGCCCTTTTTGAGGAACAGACCGAAGGATAAAGACAAAATGAAGGCCTGCTACCGTCGTTCCATG---AT
GAATGACCTGGTGCAGTCCATGGTCCTAGCAGGAGGACAGTGGACAGGTAGTACTGAGAATTTGGAGGTTCCTGATGATATTTCAACGGGTAAAAGGAGA
AAAGAATTGGGAGCTATGGCCTTCTCTACTACAGCCATCAACTTTTCAGCTGTCAACTCTTCTACAGGCTTCAGATCCAAGCAGTTGGTTAATAAT---A
CTACATCCTTTGAAGACGTAAGTCCACAAGGTATTAGTGATGATTCTAGTACGGGATCAAGAGTTCAT---TCGAGACCAGCCAGCCTTGATAGTGGCAG
AACATCCACTAGCAATAGCAATAATAATGCTTCACTCCATGAAGTCAAA---GGTGCAGTTAATATCCAAAGCAGGCCACAAAGCCACAGCAGTGGAGAA
TTTAGCCTGCTTCATGAGCATGAAGCCTGGTCCAGCAGTGGTAGCAGTCCAATCCAGTACTTGAAAAGACAAACCAGATCAAGTCCagTGCTCCAGCACA
AAACACTAGAGAGTCGAGCACATCGCAAGATCAAAAGTGGTTCCCCTGGAAGTGAAGTTGTTACTCTACAACAGTTTTTGGAAGAAAGCAACAAGCTTAC
CTCAATAATAAAGCCCTCAAGTCAAGAGAATCTTTTAGATGAAGTAATGAAAAGTTTGTCTGTATCTTCTGACTTTTTGGGAAAAAACAAACCAGTTAGC
TGTGGTCTGGCCAGGTCAGTAAGTGGAAAAACTCCTGGAGACTTCTATGACAGACGGACAACTAAGCCTGAACAGTTTGTGAGACCTGGTCCTCAAAAGA
CTGAAGATACCTATTTCATTAGTTCTTCAGGAAAGTCTACACTAGGCACTCAAGGAAAGATAAAGTTAGTAAAAGAAACTTCTCTGTCACGACAATCAAA
AGATAGTAATCCTTATGCCACTTTACCTCGTGCAAGCAGTGTGATCTCTACTGCCGAAGGAACTACTCGAAGGACAAGTATCCATGATTTTTTGACAAAA
GACAGTAGACTACCTATGTCAGTTGATTCACCACCAGCTACTGCTGATAGCAGCATCACTGCAGCATCTAGTGAGTACCATTTATACCCGTGGTCCTCTC
ATACACTTCACGGTCCAGCATATCCTGTAGGCTCTCAAGCACAAAATAATTTAGGTACAGACAAGCCCAAGTCTCCATATGCCCAGACCAGAAACTTAAG
AGCAGAAAAGTCATAttTCCTAAACCAAACTTTTGCCACTAGTAATATGTTTAATGATGCACTTGGAATATCAGCTAAAGACAGCTTAGAGTCCTTTACT
GTGGCTTATCCATCTCAGCCATTTTTATCTCTAAATACAGAATTAGTCAGTAACATAAGTGGGTTGCCTCCCAGATCAGTCACCAGAGTAATTGACCAGG
CTTCTGCTTCTTTGGATAAAGCTGTACGGAAAAATAACGAGCAGTTTTATGATAGTCAGAACTGTAGTAATAGTAACTCACAGTCTTCTGTAGATAGCAG
TGATCTTATCACTCCTGCATGTCCCTATCCTAAGGACACAGAAACCGCATTGTTGGTTTCTGAGGATAATCAAACTGTTTGGTATGAGTATGGTTGTGTA


>BGISUSP0000896090
QLEKDKKQLEKENKRLRQQAEIKDTTLEENNVKIGNLEKENKALFKEIGIYKESCIRLKELEKENKELVKRATIDIKTLVTLREDLVSEKLKTQQMNNDL
EKLTHELEKIGLNKERLLHDEQSTDD-RYKLLESKLESTLKKSLEIKEEKIAALEARLEESTNYNQQLRQELKTVKKNYEALKQRQDEERMVQSSPPTSG
EDNKWERESQETTRELLKVKDRLIEVERNNATLQAEKQALKTQLKAL-----------------------------------------------------
----------------------------------------------------------------------------YNQLLKQKGQLEDLENTLKVEQEK
MLLKSKNHETVAAEYKKLCGEND-LNHTYNQLLKETEVLQTDHKNLKSLLNNSKLEQTRLEAEFSKLKEQYQQLDITSTKLNNQCE--------------
----QIQTLMLQNRTLLEQNMESKDLFHVEQRQY-DKLNELRRQKEKLQEKIMDQYKFYDPSPPR-RGNWITLKMRKLIKSKKDVNRERQKSLTLTPTRS
HSSEGFLQLPHQDSQDSSSIGSNSLKDGQTLGTKKS--VALKRLPFLRNRPKDKDKMKACYRRSM-MNDLVQSMVLAGGQWTGSTENLEVPDDISTGKRR
KELGAMAFSTTAINFSAVNSSTGFRSKQLVNN-TTSFEDVSPQGISDDSSTGSRVH-SRPASLDSGRTSTSNSNNNASLHEVK-GAVNIQSRPQSHSSGE
FSLLHEHEAWSSSGSSPIQYLKRQTRSSPVLQHKTLESRAHRKIKSGSPGSEVVTLQQFLEESNKLTSIIKPSSQENLLDEVMKSLSVSSDFLGKNKPVS
CGLARSVSGKTPGDFYDRRTTKPEQFVRPGPQKTEDTYFISSSGKSTLGTQGKIKLVKETSLSRQSKDSNPYATLPRASSVISTAEGTTRRTSIHDFLTK
DSRLPMSVDSPPATADSSITAASSEYHLYPWSSHTLHGPAYPVGSQAQNNLGTDKPKSPYAQTRNLRAEKSYFLNQTFATSNMFNDALGISAKDSLESFT
VAYPSQPFLSLNTELVSNISGLPPRSVTRVIDQASASLDKAVRKNNEQFYDSQNCSNSNSQSSVDSSDLITPACPYPKDTETALLVSEDNQTVWYEYGCV