Sequences
EST Library Info
cut1Uterus - RNA from China
Clusters
Oligos
SNPs

Gene ID ENSG00000171492 (click for geneview)
Transcript ID ENST00000337338(link to ensembl)
Symbol LRRC5
Localtion Chromosome:1:89998625:90113580:1 band: 1p22.2
Description Leucine-rich repeat-containing protein 5 precursor (UNQ213/PRO239).
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--F--T--L--A--E--V--A--S--L--N--D--I--Q--P--T--Y--R--I--L--K--P--W--W--D--V--F--M--D--Y--L--A--V--
ATGTTTACCCTTGCGGAAGTTGCATCACTTAATGACATTCAGCCAACTTACCGAATCCTGAAACCATGGTGGGATGTGTTTATGGATTACCTAGCTGTTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
V--M--L--M--V--A--I--F--A--G--T--M--Q--L--T--K--D--Q--V--V--C--L--P--V--L--P--S--P--V--N--S--K--A--H
TTATGTTAATGGTAGCCATCTTTGCAGGAACCATGCAACTTACCAAAGATCAGGTGGTCTGTTTGCCAGTATTGCCATCTCCTGTAAATTCAAAGGCACA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--T--P--P--G--N--A--E--V--T--T--N--I--P--K--M--E--A--A--T--N--Q--D--Q--D--G--R--T--T--N--D--I--S--F-
TACACCACCAGGAAATGCCGAGGTCACCACCAACATCCCAAAGATGGAAGCAGCCACCAACCAAGACCAAGATGGGCGGACAACAAACGACATTTCCTTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--T--S--A--V--T--P--D--I--P--L--R--A--T--Y--P--R--T--D--F--A--L--P--N--Q--E--A--K--K--E--K--K--D--
GGGACATCTGCTGTGACACCTGACATACCTCTCAGAGCCACATATCCTCGCACAGATTTCGCACTTCCAAATCAGGAGGCAAAGAAAGAGAAGAAAGATC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
P--T--G--R--K--T--N--L--D--F--Q--Q--Y--V--F--I--N--Q--M--C--Y--H--L--A--L--P--W--Y--S--K--Y--F--P--Y
CAACAGGTCGAAAAACAAACTTGGATTTTCAGCAATATGTATTTATTAATCAAATGTGTTACCATCTGGCCCTTCCGTGGTATTCTAAGTACTTTCCATA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--L--A--L--I--H--T--I--I--L--M--V--S--S--N--F--W--F--K--Y--P--K--T--C--S--K--V--E--H--F--V--S--I--L-
CCTAGCTCTTATACATACTATTATTCTCATGGTCAGTAGCAACTTTTGGTTCAAATATCCCAAAACATGCTCAAAAGTAGAACATTTTGTTTCAATATTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--K--C--F--E--S--P--W--T--T--K--A--L--S--E--T--A--C--E--D--S--E--E--N--K--Q--R--I--T--G--A--Q--T--
GGAAAGTGCTTTGAATCCCCTTGGACGACAAAAGCGTTGTCTGAGACAGCATGCGAAGACTCAGAGGAAAACAAGCAGAGAATAACAGGTGCCCAGACTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
L--P--K--H--V--S--T--S--S--D--E--G--S--P--S--A--S--T--P--M--I--N--K--T--G--F--K--F--S--A--E--K--P--V
TACCAAAGCATGTTTCTACCAGCAGTGATGAAGGGAGCCCCAGTGCCAGTACACCAATGATCAATAAAACTGGCTTTAAATTTTCAGCTGAGAAGCCTGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--I--E--L--R--E--I--S--L--N--H--E--W--T--F--E--K--L--R--Q--H--I--S--R--N--A--Q--D--K--Q--E--L--H--L-
GATTGAAGTTCCCAGCATGACAATCCTGGATAAAAAGGATGGAGAGCAGGCCAAAGCCCTGTTTGAGAAAGTGAGGAAGTTCCGTGCCCATGTGGAAGAT
        :    .. :: : : :     ::.:. .:. :    :: :. .::..:  :   :     . .  .   ::  : .     :  :: :   .
-------CTGAGGGAAATCAGACTGAACCATGAGTGGACTTTCCAGAAACTCAGGGAGCACGTGTCTCGCAATGCCCAGGACAAGCAGGAGCTGCACCTC
--------L--R--E--I--R--L--N--H--E--W--T--F--Q--K--L--R--E--H--V--S--R--N--A--Q--D--K--Q--E--L--H--L-

----------------------------------------------------------------------------------------------------
-F--M--L--S--G--V--P--D--A--V--F--D--L--T--D--L--D--V--L--K--L--E--L--I--P--E--A--K--I--P--A--K--I--
AGTGACTTGATCTATAAACTCTATGTGGTCCAAACAGTTATCAAAACAGCCAAGTTCATTTTTATTCTCTGCTATACAGCGAACTTTGTCAACGCAATCA
  ..  .:: .  ... .:.: :::.::::.  .   :.:. .:  ..: :. :.: :  .:..  ::   :. .. ::::::  :: .:. :. .::: 
TTCATGCTGTCGGGCGTGCCCGATGCGGTCTTTGACCTCACGGACCTGGACGTGCTGAGGCTCGAGCTGATCCCCGAAGCGAAGATTCCCGCCAAGATCT
-F--M--L--S--G--V--P--D--A--V--F--D--L--T--D--L--D--V--L--R--L--E--L--I--P--E--A--K--I--P--A--K--I--

----------------------------------------------------------------------------------------------------
S--Q--M--T--N--L--Q--E--L--H--L--C--H--C--P--A--K--V--E--Q--T--A--F--S--F--L--R--D--H--L--R--C--L--H
GCTTTGAACACGTCTGCAAGCCCAAAGTTGAGCATCTGATTGGTTATGAGGTATTTGAGTGCACCCACAATATGGCTTACATGTTGAAAAAGCTTCTCAT
  .  . .  :. :. : :.     .  .   ...:    .  .  ..:.::.    ::  :.: . ::.. :  ....:.  .    .:.:. .::.  
CGCAGATGACCAACCTCCAAGAGCTGCACCTCTGCCACTGCCCCGCCAAAGTGGAGCAGACCGCGTTCAGCTTCCTCCGCGATCACTTGAGGTGCCTTCA
S--Q--M--T--N--L--Q--E--L--H--L--C--H--C--P--A--K--V--E--Q--T--A--F--S--F--L--R--D--H--L--R--C--L--H

----------------------------------------------------------------------------------------------------
--V--K--F--T--D--V--A--E--I--P--A--W--V--Y--L--L--K--N--L--R--E--L--Y--L--I--G--N--L--N--S--E--N--N-
CAGTTACATATCCATTATTTGTGTTTATGGCTTTATCTGCCTCTACACTCTCTTCTGGTTATTCAGGATACCTTTGAAGGAATATTCTTTCGAAAAAGTC
:.   :  :  ::. ..:    :    .  : ..      . :.   ..     :. :.           :.  :... .: .    .:. ::::: . :
CGTGAAGTTCACCGACGTGGCGGAGATCCCCGCCTGGGTGTACCTGCTCAAAAACCTGCGCGAGCTCTACCTGGTAGGCAACCTGAACTCGGAAAACAAC
--V--K--F--T--D--V--A--E--I--P--A--W--V--Y--L--L--K--N--L--R--E--L--Y--L--V--G--N--L--N--S--E--N--N-

----------------------------------------------------------------------------------------------------
-K--M--I--G--L--E--S--L--R--E--L--R--H--L--K--I--L--H--V--K--S--N--L--T--K--V--P--S--N--I--T--D--V--
AGAGAAGAGAGCAGTTTTAGTGACATTCCAGATGTCAAAAACGATTTTGCGTTCCTTCTTCACATGGTAGACCAGTATGACCAGCTATATTCCAAGCGTT
:... ..  .:         :        .       :    ..  :  . .   :     .::   :.. : :.  .  :.       . ::.:     
AAGATGATCGGACTGGAGTCTCTGCGGGAGTTGCGGCACCTGAGGGTGCTCCAGGTGAAGAGCAATTTGACCAAAGTCCCCTCCAACATCACCGACGTGG
-K--M--I--G--L--E--S--L--R--E--L--R--H--L--R--V--L--Q--V--K--S--N--L--T--K--V--P--S--N--I--T--D--V--

----------------------------------------------------------------------------------------------------
A--P--H--L--T--K--L--V--I--H--N--D--G--T--K--L--L--V--L--N--S--L--K--K--M--M--N--V--A--E--L--E--L--Q
TTGGTGTGTTCTTGTCAGAAGTTAGTGAAAATAAACTTAGGGAAATTAGTTTGAACCATGAGTGGACATTTGAAAAACTCAGGCAGCACATTTCACGCAA
..      .:: .   .  :::.: : : :::.:   .:  .:: :.    :.    :... .  : .   . .: .  ..      :  :   .: : :
CCCCGCATCTCACCAAGTTAGTCATTCACAATGACGGCACCAAACTCCTGGTACTGAACAGCCTTAAGAAAATGATGAATGTCGCCGAGCTGGAGCTCCA
A--P--H--L--T--K--L--V--I--H--N--D--G--T--K--L--L--V--L--N--S--L--K--K--M--M--N--V--A--E--L--E--L--Q

----------------------------------------------------------------------------------------------------
--N--C--E--L--E--R--I--P--H--A--I--F--S--L--S--N--L--Q--E--L--D--L--K--S--N--N--I--R--T--I--E--E--I-
CGCCCAGGACAAGCAGGAGTTGCATCTGTTCATGCTGTCGGGGGTGCCCGATGCTGTCTTTGACCTCACAGACCTGGATGTGCTAAAGCTTGAACTAATT
 . :.. ::     ::... : :  :   ..:: .:        .   :      :  .: ::::: : .  :   .:..: :  :   :.:::  :::.
GAACTGTGAGCTCGAGAGAATCCCACACGCTATTTTCAGCCTCTCCAACTTGCAGGAACTAGACCTAAAGTCCAATAACATCCGCACCATCGAAGAAATC
--N--C--E--L--E--R--I--P--H--A--I--F--S--L--S--N--L--Q--E--L--D--L--K--S--N--N--I--R--T--I--E--E--I-

----------------------------------------------------------------------------------------------------
-I--S--F--Q--H--L--K--R--L--T--C--L--K--L--W--H--N--K--I--V--T--I--P--P--S--I--T--H--V--K--N--L--E--
CCAGAAGCTAAAATTCCTGCTAAGATTTCTCAAATGACTAACCTCCAAGAGCTCCACCTCTGCCACTGCCCTGCAAAAGTTGAACAGACTGCTTTTAGCT
 . ..  .. :.  ... .   .. :  : ..  :.:     .  :: .:      : :   :  :.  ::. : :  ... :    :  . ..: .. :
ATCAGTTTCCAGCACTTGAAGCGACTGACGTGTTTAAAACTGTGGCATAACAAAATCGTGACCATCCCGCCCTCCATCACCCACGTCAAAAACCTGGAGT
-I--S--F--Q--H--L--K--R--L--T--C--L--K--L--W--H--N--K--I--V--T--I--P--P--S--I--T--H--V--K--N--L--E--

----------------------------------------------------------------------------------------------------
S--L--Y--F--S--N--N--K--L--E--S--L--P--V--A--V--F--S--L--Q--K--L--R--C--L--D--V--S--Y--N--N--I--S--M
TTCTTCGCGATCACTTGAGATGCCTTCACGTGAAGTTCACTGATGTGGCTGAAATTCCTGCCTGGGTGTATTTGCTCAAAAACCTTCGAGAGTTGTACTT
..:::..:  .. .   :.  . ::  :  .:  :.. .. :  ::: ....  : :  .  .    .:..:::  ..  :.:. : . ..  : : : .
CCCTTTACTTCTCTAACAACAAGCTGGAGTCGCTGCCGGTGGCAGTGTTCAGTTTACAGAAGCTCCGATGCTTGGATGTCAGCTATAACAGCATTTCCAC
S--L--Y--F--S--N--N--K--L--E--S--L--P--V--A--V--F--S--L--Q--K--L--R--C--L--D--V--S--Y--N--S--I--S--T

----------------------------------------------------------------------------------------------------
--I--P--I--E--I--G--L--L--Q--N--L--Q--H--L--H--I--T--G--N--K--V--D--I--L--P--K--Q--L--F--K--C--I--K-
AATAGGCAATTTGAACTCTGAAAACAATAAGATGATAGGACTTGAATCTCTCCGAGAGTTGCGGCACCTTAAGATTCTCCACGTGAAGAGCAATTTGACC
.::      .  .:       .  . : ::  ::  . . .:  : ... .  : .:   .  : :  .:  : ..   ::  ::   :.  ..   :  
GATCCCGCTCGAAATAGGATTGCTTCAGAACCTGCAGCATTTGCATCTCACGGGCAACAAAGTGGAGACTCTGCCCAAACAGTTGTTTAAATGCGGCAAG
--I--P--L--E--I--G--L--L--Q--N--L--Q--H--L--H--L--T--G--N--K--V--E--T--L--P--K--Q--L--F--K--C--G--K-

----------------------------------------------------------------------------------------------------
-L--R--T--L--N--L--G--Q--N--C--I--T--S--L--P--E--K--V--G--Q--L--S--Q--L--T--Q--L--E--L--K--G--N--C--
AAAGTTCCCTCCAACATTACAGATGTGGCTCCACATCTTACAAAGTTAGTCATTCATAATGACGGCACTAAACTCTTGGTACTGAACAGCCTTAAGAAAA
  ..   :::. ::: : . . : .    .:.   .... .   .      .:. .: :   :  :       ... : :.  :   :.    ::  .  
TTGAGGACCTTGAACCTGGGGCAGAACTGCCTCACCTCCCTCCCAGACCAGGTCGGTCAGCTCTCCCAGCTCACTCAGCTGGAGCTGAAGGGGAACTGCT
-L--R--T--L--N--L--G--Q--N--C--L--T--S--L--P--D--Q--V--G--Q--L--S--Q--L--T--Q--L--E--L--K--G--N--C--

----------------------------------------------------------------------------------------------------
L--D--R--L--P--A--Q--L--G--Q--C--R--M--L--K--K--S--G--L--V--V--E--D--H--L--F--D--T--L--P--L--E--V--K
TGATGAATGTCGCTGAGCTGGAACTCCAGAACTGTGAGCTAGAGAGAATCCCACATGCTATTTTCAGCCTCTCTAATTTACAGGAACTGGATTTAAAGTC
::.   .. :  : :  : :  .  :::: ...:.  ::: .:::.:. :   :  :. .:    .:.: :..:  :        .:.:  .  :.    
TGGACCGCCTGCCAGCCCAGCTGGGCCAGTGTCGCCTGCTCAAGAAAGGCGGCCTGGTGGTGGAAGGTCACCTTTTTGACACCCTGCCGCTCGAAGTCAA
L--D--R--L--P--A--Q--L--G--Q--C--R--L--L--K--K--G--G--L--V--V--E--G--H--L--F--D--T--L--P--L--E--V--K

----------------------------------------------------------------------------------------------------
--E--A--L--N--Q--D--I--N--I--P--F--A--N--G--I--K--R--L--T--C--L--K--L--W--H--N--K--I--V--T--I--P--P-
CAATAACATTCGCACAATTGAGGAAATCATCAGTTTCCAGCATTTAAAACGACTGACTTGTTTAAAATTATGGCATAACAAAATTGTTACTATTCCTCCC
 .: .   :  ..  :. .. ..: ::. .:  . .  :  .. :                                                       
AGAAGCGTTGAATCAAGACATAAACATTCCCTTCGCAAACGGCATT------------------------------------------------------
--E--A--L--N--Q--D--I--N--I--P--F--A--N--G--I-------------------------------------------------------

----------------------------------------------------------------------------------------------------
-S--I--T--H--V--K--N--L--E--S--L--Y--F--S--N--N--K--L--E--S--L--P--V--A--V--F--S--L--Q--K--L--R--C--
TCTATTACCCATGTCAAAAACTTGGAGTCACTTTATTTCTCTAACAACAAGCTCGAATCCTTACCAGTGGCAGTATTTAGTTTACAGAAACTCAGATGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
L--D--V--S--Y--N--N--I--S--M--I--P--I--E--I--G--L--L--Q--N--L--Q--H--L--H--I--T--G--N--K--V--D--I--L
TAGATGTGAGCTACAACAACATTTCAATGATTCCAATAGAAATAGGATTGCTTCAGAACCTGCAGCATTTGCATATCACTGGGAACAAAGTGGACATTCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--P--K--Q--L--F--K--C--I--K--L--R--T--L--N--L--G--Q--N--C--I--T--S--L--P--E--K--V--G--Q--L--S--Q--L-
GCCAAAACAATTGTTTAAATGCATAAAGTTGAGGACTTTGAATCTGGGACAGAACTGCATCACCTCACTCCCAGAGAAAGTTGGTCAGCTCTCCCAGCTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-T--Q--L--E--L--K--G--N--C--L--D--R--L--P--A--Q--L--G--Q--C--R--M--L--K--K--S--G--L--V--V--E--D--H--
ACTCAGCTGGAGCTGAAGGGGAACTGCTTGGACCGCCTGCCAGCCCAGCTGGGCCAGTGTCGGATGCTCAAGAAAAGCGGGCTTGTTGTGGAAGATCACC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------------------------------------->
L--F--D--T--L--P--L--E--V--K--E--A--L--N--Q--D--I--N--I--P--F--A--N--G--I--*-
TTTTTGATACCCTGCCACTCGAAGTCAAAGAGGCATTGAATCAAGACATAAATATTCCCTTTGCAAATGGGATTTAA
                                                                             
-----------------------------------------------------------------------------
-----------------------------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000900189
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------------------------CTGAGGGAAATCAGACTGAACCATGAGTGGACTTTCCAGAAACTCAGGGAGCACGTGTCTCGCAA
TGCCCAGGACAAGCAGGAGCTGCACCTCTTCATGCTGTCGGGCGTGCCCGATGCGGTCTTTGACCTCACGGACCTGGACGTGCTGAGGCTCGAGCTGATC
CCCGAAGCGAAGATTCCCGCCAAGATCTCGCAGATGACCAACCTCCAAGAGCTGCACCTCTGCCACTGCCCCGCCAAAGTGGAGCAGACCGCGTTCAGCT
TCCTCCGCGATCACTTGAGGTGCCTTCACGTGAAGTTCACCGACGTGGCGGAGATCCCCGCCTGGGTGTACCTGCTCAAAAACCTGCGCGAGCTCTACCT
GGTAGGCAACCTGAACTCGGAAAACAACAAGATGATCGGACTGGAGTCTCTGCGGGAGTTGCGGCACCTGAGGGTGCTCCAGGTGAAGAGCAATTTGACC
AAAGTCCCCTCCAACATCACCGACGTGGCCCCGCATCTCACCAAGTTAGTCATTCACAATGACGGCACCAAACTCCTGGTACTGAACAGCCTTAAGAAAA
TGATGAATGTCGCCGAGCTGGAGCTCCAGAACTGTGAGCTCGAGAGAATCCCACACGCTATTTTCAGCCTCTCCAACTTGCAGGAACTAGACCTAAAGTC
CAATAACATCCGCACCATCGAAGAAATCATCAGTTTCCAGCACTTGAAGCGACTGACGTGTTTAAAACTGTGGCATAACAAAATCGTGACCATCCCGCCC
TCCATCACCCACGTCAAAAACCTGGAGTCCCTTTACTTCTCTAACAACAAGCTGGAGTCGCTGCCGGTGGCAGTGTTCAGTTTACAGAAGCTCCGATGCT
TGGATGTCAGCTATAACAGCATTTCCACGATCCCGCTCGAAATAGGATTGCTTCAGAACCTGCAGCATTTGCATCTCACGGGCAACAAAGTGGAGACTCT
GCCCAAACAGTTGTTTAAATGCGGCAAGTTGAGGACCTTGAACCTGGGGCAGAACTGCCTCACCTCCCTCCCAGACCAGGTCGGTCAGCTCTCCCAGCTC
ACTCAGCTGGAGCTGAAGGGGAACTGCTTGGACCGCCTGCCAGCCCAGCTGGGCCAGTGTCGCCTGCTCAAGAAAGGCGGCCTGGTGGTGGAAGGTCACC
TTTTTGACACCCTGCCGCTCGAAGTCAAAGAAGCGTTGAATCAAGACATAAACATTCCCTTCGCAAACGGCATT


>BGISUSP0000900189
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------LREIRLNHEWTFQKLREHVSRNAQDKQELHLFMLSGVPDAVFDLTDLDVLRLELI
PEAKIPAKISQMTNLQELHLCHCPAKVEQTAFSFLRDHLRCLHVKFTDVAEIPAWVYLLKNLRELYLVGNLNSENNKMIGLESLRELRHLRVLQVKSNLT
KVPSNITDVAPHLTKLVIHNDGTKLLVLNSLKKMMNVAELELQNCELERIPHAIFSLSNLQELDLKSNNIRTIEEIISFQHLKRLTCLKLWHNKIVTIPP
SITHVKNLESLYFSNNKLESLPVAVFSLQKLRCLDVSYNSISTIPLEIGLLQNLQHLHLTGNKVETLPKQLFKCGKLRTLNLGQNCLTSLPDQVGQLSQL
TQLELKGNCLDRLPAQLGQCRLLKKGGLVVEGHLFDTLPLEVKEALNQDINIPFANGI