Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000170113 (click for geneview)
Transcript ID ENST00000337435(link to ensembl)
Symbol NIPA1
Localtion Chromosome:15:20594720:20637877:-1 band: 15q11.2
Description non-imprinted in Prader-Willi/Angelman syndrome 1 [Source:RefSeq_peptide;Acc:NP_653200]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--G--T--A--A--A--A--A--A--A--A--A--A--A--A--A--G--E--G--A--R--S--P--S--P--A--A--V--S--L--G--L--G--
ATGGGGACTGCAGCTGCGGCAGCGGCGGCGGCGGCGGCGGCGGCGGCCGGGGAGGGGGCGCGTAGCCCGAGCCCCGCCGCCGTGTCGCTCGGCCTGGGCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------------------------------------><---------------------
V--A--V--V--S--S--L--V--N--G--S--T--F--V--L--Q--K--K--G--I--V--R--A--K--R--R--G--T--S--Y--L--T--D--I
TGGCCGTCGTGTCGAGCCTGGTGAACGGGTCCACGTTCGTGCTACAGAAGAAGGGCATCGTGCGTGCCAAGCGGCGAGGTACTTCCTATTTAACAGACAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------><-------------------------------------------------------------------------
--V--W--W--A--G--T--I--A--M--A--V--G--Q--I--G--N--F--L--A--Y--T--A--V--P--T--V--L--V--T--P--L--G--A-
TGTGTGGTGGGCTGGCACAATCGCAATGGCTGTTGGCCAGATTGGAAACTTCCTGGCTTACACGGCGGTCCCCACGGTCCTGGTAACCCCCCTGGGCGCC
                            :::::::::::::::::::::::::::::::::::::::::::::::.::::::::.::.::.:: ::.:::
----------------------------GCTGTTGGCCAGATTGGAAACTTCCTGGCTTACACGGCGGTCCCCACAGTCCTGGTGACTCCTCTTGGTGCC
-----------------------------A--V--G--Q--I--G--N--F--L--A--Y--T--A--V--P--T--V--L--V--T--P--L--G--A-

----------------><----------------------------------------------------------------------------------
-L--G--V--P--F--G--S--I--L--A--S--Y--L--L--K--E--K--L--N--I--L--G--K--L--G--C--L--L--S--C--A--G--S--
CTTGGAGTACCGTTCGGGTCCATTTTAGCTTCCTATCTCCTGAAGGAAAAGCTCAACATCTTGGGCAAGTTGGGGTGCCTGCTAAGCTGTGCAGGCTCCG
::::::::.:::                                                         ::::::::.::::::::::::::.::.::.:
CTTGGAGTGCCG---------------------------------------------------------TTGGGGTGTCTGCTAAGCTGTGCGGGTTCTG
-L--G--V--P-----------------------------------------------------------L--G--C--L--L--S--C--A--G--S--

-----------------------------------------------------------------------------><---------------------
V--V--L--I--I--H--S--P--K--S--E--S--V--T--T--Q--A--E--L--E--E--K--L--T--N--P--V--F--V--G--Y--L--C--I
TCGTGCTGATTATCCACTCCCCAAAGTCTGAGAGTGTGACAACTCAGGCTGAGCTGGAGGAAAAGCTGACCAATCCAGTGTTTGTGGGCTACCTGTGCAT
::::::::::::::::::::::.::.:::::::::::::: ::::::::::::::::::::.:::::::::::.:::   :::::::::::.::::::::
TCGTGCTGATTATCCACTCCCCGAAATCTGAGAGTGTGACCACTCAGGCTGAGCTGGAGGAGAAGCTGACCAACCCA---TTTGTGGGCTATCTGTGCAT
V--V--L--I--I--H--S--P--K--S--E--S--V--T--T--Q--A--E--L--E--E--K--L--T--N--P-----F--V--G--Y--L--C--I

----------------------------------------------------------------------------------------------------
--V--L--L--M--L--L--L--L--I--F--W--I--A--P--A--H--G--P--T--N--I--M--V--Y--I--S--I--C--S--L--L--G--S-
CGTGCTGCTCATGCTGCTGCTGCTCATCTTCTGGATCGCGCCGGCCCATGGGCCCACCAACATCATGGTCTACATCAGCATCTGCTCCTTGCTGGGCAGT
::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::: :::
CGTGCTGCTCATGCTGCTGCTGCTCATCTTCTGGATCGCGCCGGCCCACGGGCCCACCAACATCATGGTCTACATCAGCATCTGCTCCTTGCTGGGGAGT
--V--L--L--M--L--L--L--L--I--F--W--I--A--P--A--H--G--P--T--N--I--M--V--Y--I--S--I--C--S--L--L--G--S-

----------------------------------------------------------------------------------------------------
-F--T--V--P--S--T--K--G--I--G--L--A--A--Q--D--I--L--H--N--N--P--S--S--Q--R--A--L--C--L--C--L--V--L--
TTCACCGTGCCTTCCACCAAGGGCATCGGGCTGGCGGCCCAAGACATCTTGCATAACAACCCGTCCAGTCAGAGAGCCCTCTGCCTGTGCCTGGTACTCC
:::::.::::::::::::::::::::.::::::::.:::::::::::::: ::.:::::::::::.::.::: :.:::::::::::.::::::::.::::
TTCACTGTGCCTTCCACCAAGGGCATTGGGCTGGCAGCCCAAGACATCTTCCACAACAACCCGTCTAGCCAGCGGGCCCTCTGCCTATGCCTGGTGCTCC
-F--T--V--P--S--T--K--G--I--G--L--A--A--Q--D--I--F--H--N--N--P--S--S--Q--R--A--L--C--L--C--L--V--L--

----------------------------------------------------------------------------------------------------
L--A--V--L--G--C--S--I--I--V--Q--F--R--Y--I--N--K--A--L--E--C--F--D--S--S--V--F--G--A--I--Y--Y--V--V
TGGCCGTGCTCGGCTGCAGCATCATCGTCCAGTTCAGGTACATCAACAAGGCGCTGGAGTGCTTCGACTCCTCGGTGTTCGGGGCCATCTACTACGTCGT
::::::::::.:::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::: :: ::.:::::::::::::::::.::
TGGCCGTGCTTGGCTGCAGCATCATCGTCCAGTTCAGGTACATCAACAAGGCGCTCGAGTGCTTCGACTCCTCCGTTTTTGGGGCCATCTACTACGTTGT
L--A--V--L--G--C--S--I--I--V--Q--F--R--Y--I--N--K--A--L--E--C--F--D--S--S--V--F--G--A--I--Y--Y--V--V

----------------------------------------------------------------------------------------------------
--F--T--T--L--V--L--L--A--S--A--I--L--F--R--E--W--S--N--V--G--L--V--D--F--L--G--M--A--C--G--F--T--T-
GTTTACCACGCTGGTCCTGCTGGCCTCAGCCATCCTCTTCCGGGAGTGGAGCAACGTGGGCCTGGTGGACTTCTTGGGGATGGCCTGTGGATTCACGACC
:::.::::: ::::::.:::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::: ::::::::.::.::::: ::.
GTTCACCACTCTGGTCTTGCTGGCCTCAGCCATCCTCTTCCGGGAGTGGAGCAACGTGGGTCTGGTGGACTTCTTGGGCATGGCCTGCGGGTTCACCACT
--F--T--T--L--V--L--L--A--S--A--I--L--F--R--E--W--S--N--V--G--L--V--D--F--L--G--M--A--C--G--F--T--T-

---------------------------------------------------------------------------------------------
-V--S--V--G--I--V--L--I-----Q--V--F--K--E--F--N--F--N--L--G--E--M--N--K--S--N--M--K--T--D--*-
GTCTCCGTGGGGATTGTCCTTATA---CAGGTGTTCAAAGAGTTCAATTTCAACCTTGGGGAGATGAACAAATCTAATATGAAAACAGACTAG
:::::.:: :::::::::::.:::   ::::::::::::::::::::.::::::::::::::::::::::: ::::::.:::::         
GTCTCTGTCGGGATTGTCCTCATAC--CAGGTGTTCAAAGAGTTCAACTTCAACCTTGGGGAGATGAACAA-TCTAATGTGAAA---------
-V--S--V--G--I--V--L--I--\--Q--V--F--K--E--F--N--F--N--L--G--E--M--N--K--S--N--V--K----------

Pig Consensus Sequence

>BGISUST0000898911
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------GCTGTTGGCCAGATTGGAAACTTCCTGGCTTACACGGCGGTCCCCACAGTCCTGGTGACTCCTCTTGGTGCC
CTTGGAGTGCCG---------------------------------------------------------TTGGGGTGTCTGCTAAGCTGTGCGGGTTCTG
TCGTGCTGATTATCCACTCCCCGAAATCTGAGAGTGTGACCACTCAGGCTGAGCTGGAGGAGAAGCTGACCAACCCA---TTTGTGGGCTATCTGTGCAT
CGTGCTGCTCATGCTGCTGCTGCTCATCTTCTGGATCGCGCCGGCCCACGGGCCCACCAACATCATGGTCTACATCAGCATCTGCTCCTTGCTGGGGAGT
TTCACTGTGCCTTCCACCAAGGGCATTGGGCTGGCAGCCCAAGACATCTTCCACAACAACCCGTCTAGCCAGCGGGCCCTCTGCCTATGCCTGGTGCTCC
TGGCCGTGCTTGGCTGCAGCATCATCGTCCAGTTCAGGTACATCAACAAGGCGCTCGAGTGCTTCGACTCCTCCGTTTTTGGGGCCATCTACTACGTTGT
GTTCACCACTCTGGTCTTGCTGGCCTCAGCCATCCTCTTCCGGGAGTGGAGCAACGTGGGTCTGGTGGACTTCTTGGGCATGGCCTGCGGGTTCACCACT
GTCTCTGTCGGGATTGTCCTCATacAGGTGTTCAAAGAGTTCAACTTCAACCTTGGGGAGATGAActCTAATGTGAAA---------


>BGISUSP0000898911
----------------------------------------------------------------------------AVGQIGNFLAYTAVPTVLVTPLGA
LGVP-------------------LGCLLSCAGSVVLIIHSPKSESVTTQAELEEKLTNP-FVGYLCIVLLMLLLLIFWIAPAHGPTNIMVYISICSLLGS
FTVPSTKGIGLAAQDIFHNNPSSQRALCLCLVLLAVLGCSIIVQFRYINKALECFDSSVFGAIYYVVFTTLVLLASAILFREWSNVGLVDFLGMACGFTT
VSVGIVLIQVFKEFNFNLGEMNSNVK---