Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000164683 (click for geneview)
Transcript ID ENST00000337919(link to ensembl)
Symbol HEY1
Localtion Chromosome:8:80838801:80842559:-1 band: 8q21.13
Description Hairy/enhancer-of-split related with YRPW motif 1 (Hairy and enhancer of split related-1) (HESR-1) (Cardiovascular helix-loop-helix factor 2) (HES-related repressor protein 2 HERP2). [Source:Uniprot/SWISSPROT;Acc:Q9Y5J3]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------><----------
-M--K--R--A--H--P--E--Y--S--S--S--D--S--E--L--D--E--T--I--E--V--E--K--E--S--A--D--E--N--G--N--L--S--
ATGAAGCGAGCTCACCCCGAGTACAGCTCCTCGGACAGCGAGCTGGACGAGACCATCGAGGTGGAGAAGGAGAGTGCGGACGAGAATGGAAACTTGAGTT
:::::::::::.:::::::::::::::::::: ::.:::::.:::::::::::::::::::::::.::::::::::::::.::::::   ::::::::::
ATGAAGCGAGCCCACCCCGAGTACAGCTCCTCCGATAGCGAACTGGACGAGACCATCGAGGTGGAAAAGGAGAGTGCGGATGAGAAT---AACTTGAGTT
-M--K--R--A--H--P--E--Y--S--S--S--D--S--E--L--D--E--T--I--E--V--E--K--E--S--A--D--E--N-----N--L--S--

----------------------------------------------------------------><----------------------------------
S--A--L--G--S--M--S--P--T--T--S--S--Q--I--L--A--R--K--R--R--R--G--I--I--E--K--R--R--R--D--R--I--N--N
CGGCTCTAGGTTCCATGTCCCCAACTACATCTTCCCAGATTTTGGCCAGAAAAAGACGGAGAGGAATAATTGAGAAGCGCCGACGAGACCGGATCAATAA
:::::.:::::::::::::::::::::::::::: :::::.:::::::::::::::::::::   :: :::::::::::::: :::::::::::::::::
CGGCTTTAGGTTCCATGTCCCCAACTACATCTTCACAGATCTTGGCCAGAAAAAGACGGAGA---ATCATTGAGAAGCGCCGTCGAGACCGGATCAATAA
S--A--L--G--S--M--S--P--T--T--S--S--Q--I--L--A--R--K--R--R--R-----I--I--E--K--R--R--R--D--R--I--N--N

------------------------------------------------><--------------------------------------------------
--S--L--S--E--L--R--R--L--V--P--S--A--F--E--K--Q--G--S--A--K--L--E--K--A--E--I--L--Q--M--T--V--D--H-
CAGTTTGTCTGAGCTGAGAAGGCTGGTACCCAGTGCTTTTGAGAAGCAGGGATCTGCTAAGCTAGAAAAAGCCGAGATCCTGCAGATGACCGTGGATCAC
::::::::::::::::::.::::::::::::::::::::::::::::::                     :::::::::::::::::::: :::::::::
CAGTTTGTCTGAGCTGAGGAGGCTGGTACCCAGTGCTTTTGAGAAGCAG---------------------GCCGAGATCCTGCAGATGACGGTGGATCAC
--S--L--S--E--L--R--R--L--V--P--S--A--F--E--K--Q-----------------------A--E--I--L--Q--M--T--V--D--H-

------------------------------><--------------------------------------------------------------------
-L--K--M--L--H--T--A--G--G--K--G--Y--F--D--A--H--A--L--A--M--D--Y--R--S--L--G--F--R--E--C--L--A--E--
CTGAAAATGCTGCATACGGCAGGAGGGAAAGGTTACTTTGACGCGCACGCCCTTGCTATGGACTATCGGAGTTTGGGATTTCGGGAATGCCTGGCAGAAG
::::::::::::::.:: ::::: ::::::   ::.:::::.:::::::::::::::::::::::::::::::::::.::::::::::::::::::::::
CTGAAAATGCTGCACACCGCAGGCGGGAAA---TATTTTGATGCGCACGCCCTTGCTATGGACTATCGGAGTTTGGGGTTTCGGGAATGCCTGGCAGAAG
-L--K--M--L--H--T--A--G--G--K-----Y--F--D--A--H--A--L--A--M--D--Y--R--S--L--G--F--R--E--C--L--A--E--

----------------------------------------------------------------------------------------------------
V--A--R--Y--L--S--I--I--E--G--L--D--A--S--D--P--L--R--V--R--L--V--S--H--L--N--N--Y--A--S--Q--R--E--A
TTGCGCGTTATCTGAGCATCATTGAAGGACTAGATGCCTCTGACCCGCTTCGAGTTCGACTGGTTTCGCATCTCAACAACTACGCTTCCCAGCGGGAAGC
:.:: :::::.::::::::::::::::::::::::::::::::::: ::::: :::::::::::.:::::::: ::::::::.::.::::::::::::::
TCGCCCGTTACCTGAGCATCATTGAAGGACTAGATGCCTCTGACCCTCTTCGCGTTCGACTGGTCTCGCATCTGAACAACTATGCCTCCCAGCGGGAAGC
V--A--R--Y--L--S--I--I--E--G--L--D--A--S--D--P--L--R--V--R--L--V--S--H--L--N--N--Y--A--S--Q--R--E--A

----------------------------------------------------------------------------------------------------
--A--S--G--A--H--A--G--L--G--H--I--P--W--G--T--V--F--G--H--H--P--H--I--A--H--P--L--L--L--P--Q--N--G-
CGCGAGCGGCGCCCACGCGGGCCTCGGACACATTCCCTGGGGGACCGTCTTCGGACATCACCCGCACATCGCGCACCCGCTGTTGCTGCCCCAGAACGGC
 :: ::::::::::::::.:::::.:::::.::::::::::::: ::.:::::::::::::::.:::.:::::::::: :::::::::::::::::::::
GGCCAGCGGCGCCCACGCAGGCCTTGGACATATTCCCTGGGGGAGCGCCTTCGGACATCACCCACACGTCGCGCACCCCCTGTTGCTGCCCCAGAACGGC
--A--S--G--A--H--A--G--L--G--H--I--P--W--G--S--A--F--G--H--H--P--H--V--A--H--P--L--L--L--P--Q--N--G-

----------------------------------------------------------------------------------------------------
-H--G--N--A--G--T--T--A--S--P--T--E--P--H--H--Q--G--R--L--G--S--A--H--P--E--A--P--A--L--R--A--P--P--
CACGGGAACGCGGGCACCACGGCCTCACCCACGGAACCGCACCACCAGGGCAGGCTGGGCTCGGCACATCCGGAGGCGCCTGCTTTGCGAGCGCCCCCTA
::::::::::: :::::::: ::.::.::::::::::: :::::::::::::::.::: : :::::::::::::::::::.:::::::::::::::::::
CACGGGAACGCTGGCACCACCGCTTCGCCCACGGAACCCCACCACCAGGGCAGGTTGGCCACGGCACATCCGGAGGCGCCCGCTTTGCGAGCGCCCCCTA
-H--G--N--A--G--T--T--A--S--P--T--E--P--H--H--Q--G--R--L--A--T--A--H--P--E--A--P--A--L--R--A--P--P--

----------------------------------------------------------------------------------------------------
S--G--S--L--G--P--V--L--P--V--V--T--S--A--S--K--L--S--P--P--L--L--S--S--V--A--S--L--S--A--F--P--F--S
GCGGCAGCCTCGGACCGGTGCTCCCTGTGGTCACCTCCGCCTCCAAACTGTCGCCGCCTCTGCTCTCCTCAGTGGCCTCCCTGTCGGCCTTCCCCTTCTC
:::::.::::.:::::.::::::::.::::::::::::::::::::::: ::::::::.:::::::::::.::.::::::::::: ::::::::::::::
GCGGCGGCCTTGGACCAGTGCTCCCCGTGGTCACCTCCGCCTCCAAACTCTCGCCGCCCCTGCTCTCCTCGGTAGCCTCCCTGTCTGCCTTCCCCTTCTC
S--G--G--L--G--P--V--L--P--V--V--T--S--A--S--K--L--S--P--P--L--L--S--S--V--A--S--L--S--A--F--P--F--S

----------------------------------------------------------------------------------------------------
--F--G--S--F--H--L--L--S--P--N--A--L--S--P--S--A--P--T--Q--A--A--N--L--G--K--P--Y--R--P--W--G--T--E-
TTTCGGCTCCTTCCACTTACTGTCTCCCAATGCACTGAGCCCTTCAGCACCCACGCAGGCTGCAAACCTTGGCAAGCCCTATAGACCTTGGGGGACGGAG
::::::::::::::::::::: :::::::::::.:::::::::::.:::::::::::.:::::::::::::::::.::::::::::::::::::::.:::
TTTCGGCTCCTTCCACTTACTCTCTCCCAATGCGCTGAGCCCTTCGGCACCCACGCAAGCTGCAAACCTTGGCAAACCCTATAGACCTTGGGGGACAGAG
--F--G--S--F--H--L--L--S--P--N--A--L--S--P--S--A--P--T--Q--A--A--N--L--G--K--P--Y--R--P--W--G--T--E-

-------------->
-I--G--A--F--*-
ATCGGAGCTTTTTAA
:::::::::::::::
ATCGGAGCTTTTTAA
-I--G--A--F--*-

Pig Consensus Sequence

>BGISUST0000888845
ATGAAGCGAGCCCACCCCGAGTACAGCTCCTCCGATAGCGAACTGGACGAGACCATCGAGGTGGAAAAGGAGAGTGCGGATGAGAAT---AACTTGAGTT
CGGCTTTAGGTTCCATGTCCCCAACTACATCTTCACAGATCTTGGCCAGAAAAAGACGGAGA---ATCATTGAGAAGCGCCGTCGAGACCGGATCAATAA
CAGTTTGTCTGAGCTGAGGAGGCTGGTACCCAGTGCTTTTGAGAAGCAG---------------------GCCGAGATCCTGCAGATGACGGTGGATCAC
CTGAAAATGCTGCACACCGCAGGCGGGAAA---TATTTTGATGCGCACGCCCTTGCTATGGACTATCGGAGTTTGGGGTTTCGGGAATGCCTGGCAGAAG
TCGCCCGTTACCTGAGCATCATTGAAGGACTAGATGCCTCTGACCCTCTTCGCGTTCGACTGGTCTCGCATCTGAACAACTATGCCTCCCAGCGGGAAGC
GGCCAGCGGCGCCCACGCAGGCCTTGGACATATTCCCTGGGGGAGCGCCTTCGGACATCACCCACACGTCGCGCACCCCCTGTTGCTGCCCCAGAACGGC
CACGGGAACGCTGGCACCACCGCTTCGCCCACGGAACCCCACCACCAGGGCAGGTTGGCCACGGCACATCCGGAGGCGCCCGCTTTGCGAGCGCCCCCTA
GCGGCGGCCTTGGACCAGTGCTCCCCGTGGTCACCTCCGCCTCCAAACTCTCGCCGCCCCTGCTCTCCTCGGTAGCCTCCCTGTCTGCCTTCCCCTTCTC
TTTCGGCTCCTTCCACTTACTCTCTCCCAATGCGCTGAGCCCTTCGGCACCCACGCAAGCTGCAAACCTTGGCAAACCCTATAGACCTTGGGGGACAGAG
ATCGGAGCTTTTTAA


>BGISUSP0000888845
MKRAHPEYSSSDSELDETIEVEKESADEN-NLSSALGSMSPTTSSQILARKRRR-IIEKRRRDRINNSLSELRRLVPSAFEKQ-------AEILQMTVDH
LKMLHTAGGK-YFDAHALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGSAFGHHPHVAHPLLLPQNG
HGNAGTTASPTEPHHQGRLATAHPEAPALRAPPSGGLGPVLPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAANLGKPYRPWGTE
IGAF*