Sequences
EST Library Info
cbl1Blood
cbr10Brain - RNA from China
fat1Fatt
nca1Newborn 115 days, cartillage
Clusters
Oligos
SNPs

Gene ID ENSG00000163947 (click for geneview)
Transcript ID ENST00000338458(link to ensembl)
Localtion Chromosome:3:56736486:57088333:-1 band: 3p14.3
Description Rho guanine nucleotide exchange factor 3 (Exchange factor found in platelets and leukemic and neuronal tissues) (XPLN). [Source:Uniprot/SWISSPROT;Acc:Q9NR81]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<------------------------------------------------------------><-------------------------------------
-M--D--S--S--T--A--M--N--Q--C--S--C--R--G--M--E--E--N--K--E--R--P--K--R--Q--R--Q--N--N--F--P--M--F--
ATGGACAGTTCCACAGCAATGAATCAATGCAGCTGTAGAGGAATGGAAGAAAACAAGGAAAGGCCTAAACGGCAGCGGCAAAACAACTTTCCCATGTTTC
::::::::::::: ::.:::::::::.::.. :: :::::::::::::::::::::::::   :::::::::::::::::::::::::::::::::::::
ATGGACAGTTCCAGAGTAATGAATCAGTGTGTCTTTAGAGGAATGGAAGAAAACAAGGAA---CCTAAACGGCAGCGGCAAAACAACTTTCCCATGTTTC
-M--D--S--S--R--V--M--N--Q--C--V--F--R--G--M--E--E--N--K--E-----P--K--R--Q--R--Q--N--N--F--P--M--F--

----------------------------><-------------------------------------------------------------><-------
P--S--P--K--A--W--N--F--R--G--R--K--R--K--Q--S--T--Q--D--E--D--A--V--S--L--C--S--L--D--I--S--E--P--S
CCTCTCCTAAAGCCTGGAATTTCAGAGGGCGAAAACGGAAACAGAGCACCCAAGATGAAGATGCTGTTAGCCTTTGCAGTCTCGACATAAGTGAGCCTAG
: ::::::::::::::::::::::::::::::::.:::::.:::::::::::::::::::::::.:::::.:::::::::::.::.::::::::.::.::
CATCTCCTAAAGCCTGGAATTTCAGAGGGCGAAAGCGGAAGCAGAGCACCCAAGATGAAGATGCCGTTAGTCTTTGCAGTCTTGATATAAGTGAACCCAG
P--S--P--K--A--W--N--F--R--G--R--K--R--K--Q--S--T--Q--D--E--D--A--V--S--L--C--S--L--D--I--S--E--P--S

--------------------------------------------------------------------------------------------------->
--N--K--R--V--K--P--L--S--R--V--T--S--L--A--N--L--I--P--P--V--K--A--T--P--L--K--R--F--S--Q--T--L--Q-
TAATAAACGGGTCAAACCCCTTTCCCGAGTCACGTCGCTAGCAAACCTCATCCCGCCCGTGAAGGCCACGCCATTAAAGCGCTTCAGTCAAACCCTGCAG
:::::::::.::::::::::::::: :::::::.::::::::::::::::::::::::::.:::::::::::.:::::::::::.::.:::::.::::::
TAATAAACGAGTCAAACCCCTTTCCAGAGTCACATCGCTAGCAAACCTCATCCCGCCCGTAAAGGCCACGCCGTTAAAGCGCTTTAGCCAAACTCTGCAG
--N--K--R--V--K--P--L--S--R--V--T--S--L--A--N--L--I--P--P--V--K--A--T--P--L--K--R--F--S--Q--T--L--Q-

<---------------------------------------------------------------------------------------------------
-R--S--I--S--F--R--S--E--S--R--P--D--I--L--A--P--R--P--W--S--R--N--A--A--P--S--S--T--K--R--R--D--S--
CGCTCCATTAGCTTCCGCAGTGAGAGCCGCCCTGACATCCTCGCCCCCCGACCCTGGTCCAGAAATGCCGCCCCCTCGAGCACGAAACGGAGAGATAGCA
::::::::.:::::::: ::.:::::::: :::::::::::::::::: ::::::::::::::::::::::::::::.:::::.:::::::::::.::::
CGCTCCATCAGCTTCCGAAGCGAGAGCCGGCCTGACATCCTCGCCCCCAGACCCTGGTCCAGAAATGCCGCCCCCTCAAGCACAAAACGGAGAGACAGCA
-R--S--I--S--F--R--S--E--S--R--P--D--I--L--A--P--R--P--W--S--R--N--A--A--P--S--S--T--K--R--R--D--S--

----------------------------------------------------------------------><----------------------------
K--L--W--S--E--T--F--D--V--C--V--N--Q--M--L--T--S--K--E--I--K--R--Q--E--A--I--F--E--L--S--Q--G--E--E
AGCTGTGGAGTGAGACCTTCGATGTGTGCGTCAATCAGATGCTTACATCCAAGGAAATCAAACGTCAGGAGGCGATCTTTGAGCTTTCCCAAGGAGAAGA
::::  ::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::: :::::::::::.::::::::::::::
AGCTTGGGAGTGAGACCTTCGATGTGTGTGTCAATCAGATGCTTACATCCAAGGAAATCAAACGTCAGGAGGCCATCTTTGAGCTCTCCCAAGGAGAAGA
K--L--G--S--E--T--F--D--V--C--V--N--Q--M--L--T--S--K--E--I--K--R--Q--E--A--I--F--E--L--S--Q--G--E--E

---------------------------------><-----------------------------------------------------------------
--D--L--I--E--D--L--K--L--A--K--K--A--Y--H--D--P--M--L--K--L--S--I--M--T--E--Q--E--L--N--Q--I--F--G-
AGACTTGATAGAAGACTTGAAATTAGCAAAAAAGGCCTATCATGACCCCATGCTGAAACTCTCCATAATGACAGAACAAGAGTTGAATCAAATTTTTGGA
::::::.:::::.:::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
AGACTTAATAGAGGACTTGAAATTGGCAAAAAAGGCCTATCATGACCCCATGCTGAAACTCTCCATAATGACAGAACAAGAGTTGAATCAAATTTTTGGA
--D--L--I--E--D--L--K--L--A--K--K--A--Y--H--D--P--M--L--K--L--S--I--M--T--E--Q--E--L--N--Q--I--F--G-

------------------------------><--------------------------------------------------------------------
-T--L--D--S--L--I--P--L--H--E--E--L--L--S--Q--L--R--D--V--R--K--P--D--G--S--T--E--H--V--G--P--I--L--
ACACTGGACTCTCTAATTCCTCTACATGAAGAGCTCCTTAGTCAGCTTCGAGATGTTAGGAAGCCTGATGGCTCGACTGAACATGTTGGTCCCATCCTCG
:::::::::::..:::::::::::::.:::   :::::::::::::::::::::::. :::::::::::::::::::::::::.:::::::::::.::::
ACACTGGACTCCTTAATTCCTCTACACGAA---CTCCTTAGTCAGCTTCGAGATGTCCGGAAGCCTGATGGCTCGACTGAACACGTTGGTCCCATTCTCG
-T--L--D--S--L--I--P--L--H--E-----L--L--S--Q--L--R--D--V--R--K--P--D--G--S--T--E--H--V--G--P--I--L--

-------><-------------------------------------------------------------------------------------------
V--G--W--L--P--C--L--S--S--Y--D--S--Y--C--S--N--Q--V--A--A--K--A--L--L--D--H--K--K--Q--D--H--R--V--Q
TGGGCTGGCTCCCTTGCCTCAGCTCCTATGATAGCTACTGCAGCAATCAAGTAGCCGCCAAAGCTCTGCTGGACCACAAAAAGCAAGATCACCGAGTCCA
::::::::::::::::.::.:::::::::::.:::::::::::::::::::::::.:::::.:::::::::::::::::.::.:::::::::::::::::
TGGGCTGGCTCCCTTGTCTTAGCTCCTATGACAGCTACTGCAGCAATCAAGTAGCTGCCAAGGCTCTGCTGGACCACAAGAAACAAGATCACCGAGTCCA
V--G--W--L--P--C--L--S--S--Y--D--S--Y--C--S--N--Q--V--A--A--K--A--L--L--D--H--K--K--Q--D--H--R--V--Q

----------------------------------------------------------------------------------------------------
--D--F--L--Q--R--C--L--E--S--P--F--S--R--K--L--D--L--W--N--F--L--D--I--P--R--S--R--L--V--K--Y--P--L-
GGATTTCCTACAGCGATGTTTAGAATCCCCCTTTAGCCGCAAACTAGATCTCTGGAATTTCCTCGATATTCCAAGAAGCCGCCTGGTAAAATACCCTCTG
.::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::.:::::.::::::::::::
AGACTTCCTACAGCGATGTTTAGAATCCCCCTTTAGCCGCAAACTAGATCTCTGGAATTTCCTTGATATTCCAAGAAGCCGTCTGGTGAAATACCCTCTG
--D--F--L--Q--R--C--L--E--S--P--F--S--R--K--L--D--L--W--N--F--L--D--I--P--R--S--R--L--V--K--Y--P--L-

-----------------------------------------------------------------><---------------------------------
-L--L--R--E--I--L--R--H--T--P--N--D--N--P--D--Q--Q--H--L--E--E--A--I--N--I--I--Q--G--I--V--A--E--I--
CTTCTCCGAGAAATCTTGAGGCACACACCAAATGATAATCCAGATCAGCAGCACTTGGAAGAAGCTATAAATATCATTCAGGGAATTGTGGCAGAAATCA
:::::.:::::::::::::::::::::::.::::::::::::::::::::::::.:::::::::::                                  
CTTCTTCGAGAAATCTTGAGGCACACACCGAATGATAATCCAGATCAGCAGCACCTGGAAGAAGCT----------------------------------
-L--L--R--E--I--L--R--H--T--P--N--D--N--P--D--Q--Q--H--L--E--E--A-----------------------------------

----------------------------------------------------------------------------------------------------
N--T--K--T--G--E--S--E--C--R--Y--Y--K--E--R--L--L--Y--L--E--E--G--Q--K--D--S--L--I--D--S--S--R--V--L
ACACCAAGACTGGTGAATCTGAATGCCGCTATTATAAAGAGCGGCTTCTTTACTTGGAAGAAGGCCAGAAAGACTCCCTGATCGACAGCTCTCGAGTCTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------><--------------------------------------------------------------
--C--C--H--G--E--L--K--N--N--R--G--V--K--L--H--V--F--L--F--Q--E--V--L--V--I--T--R--A--V--T--H--N--E-
GTGTTGTCATGGTGAACTGAAGAACAATCGGGGCGTGAAACTGCATGTTTTCCTGTTCCAAGAAGTGCTTGTGATCACTCGAGCCGTCACCCACAATGAG
                                     ::::::::::::::::: ::::::::::::::::::::::::::::::::::::::::::::.
-------------------------------------AAACTGCATGTTTTCCTCTTCCAAGAAGTGCTTGTGATCACTCGAGCCGTCACCCACAATGAA
--------------------------------------K--L--H--V--F--L--F--Q--E--V--L--V--I--T--R--A--V--T--H--N--E-

----------------------------------------------------------------------------------------------------
-Q--L--C--Y--Q--L--Y--R--Q--P--I--P--V--K--D--L--L--L--E--D--L--Q--D--G--E--V--R--L--G--G--S--L--R--
CAGCTTTGCTACCAGCTGTACCGTCAGCCAATCCCCGTGAAAGACCTCCTGCTGGAAGACCTCCAGGATGGAGAAGTGAGGCTGGGTGGCTCCCTGCGAG
:::::.:::::::::.::::::: ::::: :::::::::::.:::::::::::::::::::: :::::.::::::::: :::::::.:::::::::::::
CAGCTCTGCTACCAGTTGTACCGACAGCCTATCCCCGTGAAGGACCTCCTGCTGGAAGACCTGCAGGACGGAGAAGTGCGGCTGGGCGGCTCCCTGCGAG
-Q--L--C--Y--Q--L--Y--R--Q--P--I--P--V--K--D--L--L--L--E--D--L--Q--D--G--E--V--R--L--G--G--S--L--R--

-----------------------><---------------------------------------------------------------------------
G--A--F--S--N--N--E--R--I--K--N--F--F--R--V--S--F--K--N--G--S--Q--S--Q--T--H--S--L--Q--A--N--D--T--F
GGGCATTCAGCAACAATGAGAGAATTAAAAACTTCTTCAGAGTCAGTTTCAAAAATGGATCCCAAAGTCAGACCCACTCGCTACAAGCCAATGACACTTT
:::::::::::::::::::::::   ::::::::::::::::: :::::::::::::::::::::::::::::::::::.::.::.:::::.:::::.::
GGGCATTCAGCAACAATGAGAGA---AAAAACTTCTTCAGAGTAAGTTTCAAAAATGGATCCCAAAGTCAGACCCACTCACTGCAGGCCAACGACACCTT
G--A--F--S--N--N--E--R-----K--N--F--F--R--V--S--F--K--N--G--S--Q--S--Q--T--H--S--L--Q--A--N--D--T--F

----------------------------------------------------------------------------------------------------
--N--K--Q--Q--W--L--N--C--I--R--Q--A--K--E--T--V--L--C--A--A--G--Q--A--G--V--L--D--S--E--G--S--F--L-
CAACAAACAGCAGTGGCTTAACTGTATTCGTCAAGCCAAAGAAACAGTTTTGTGTGCTGCCGGGCAAGCTGGGGTGCTTGACTCCGAGGGATCGTTCCTA
::::::::::::::::::.:::::::::::::::::::::::.:::::::::::::::::.:: ::.::::::::.::::::::.::::::.::::::::
CAACAAACAGCAGTGGCTCAACTGTATTCGTCAAGCCAAAGAGACAGTTTTGTGTGCTGCTGGCCAGGCTGGGGTACTTGACTCTGAGGGACCGTTCCTA
--N--K--Q--Q--W--L--N--C--I--R--Q--A--K--E--T--V--L--C--A--A--G--Q--A--G--V--L--D--S--E--G--P--F--L-

----------------------------------------------------------------------------------------------------
-N--P--T--T--G--S--R--E--L--Q--G--E--T--K--L--E--Q--M--D--Q--S--D--S--E--S--D--C--S--M--D--T--S--E--
AATCCCACCACCGGGAGCAGAGAGCTACAGGGAGAAACAAAACTTGAGCAGATGGACCAATCGGACAGTGAGTCAGACTGTAGTATGGACACGAGTGAGG
.:::::.:::::.::.::::.::::::::.:::::::::::::::::::::::::::::.::.::::::::.:::::.::::::::::::::::::::.:
GATCCCGCCACCAGGGGCAGGGAGCTACAAGGAGAAACAAAACTTGAGCAGATGGACCAGTCAGACAGTGAATCAGATTGTAGTATGGACACGAGTGAAG
-D--P--A--T--R--G--R--E--L--Q--G--E--T--K--L--E--Q--M--D--Q--S--D--S--E--S--D--C--S--M--D--T--S--E--

---------------------------------------------------------------------------->
V--S--L--D--C--E--R--M--E--Q--T--D--S--S--C--G--N--S--R--H--G--E--S--N--V--*-
TCAGCCTCGACTGTGAGCGCATGGAACAGACAGACTCTTCCTGTGGAAACAGCAGGCACGGTGAAAGTAACGTCTGA
::::::: :::::::::::::::::.::.:::::::::::::::::.:::::::::::.: ::::::.::.::::::
TCAGCCTAGACTGTGAGCGCATGGAGCAAACAGACTCTTCCTGTGGGAACAGCAGGCATGTTGAAAGCAATGTCTGA
V--S--L--D--C--E--R--M--E--Q--T--D--S--S--C--G--N--S--R--H--V--E--S--N--V--*-

Pig Consensus Sequence

>BGISUST0000900718
ATGGACAGTTCCAGAGTAATGAATCAGTGTGTCTTTAGAGGAATGGAAGAAAACAAGGAA---CCTAAACGGCAGCGGCAAAACAACTTTCCCATGTTTC
CATCTCCTAAAGCCTGGAATTTCAGAGGGCGAAAGCGGAAGCAGAGCACCCAAGATGAAGATGCCGTTAGTCTTTGCAGTCTTGATATAAGTGAACCCAG
TAATAAACGAGTCAAACCCCTTTCCAGAGTCACATCGCTAGCAAACCTCATCCCGCCCGTAAAGGCCACGCCGTTAAAGCGCTTTAGCCAAACTCTGCAG
CGCTCCATCAGCTTCCGAAGCGAGAGCCGGCCTGACATCCTCGCCCCCAGACCCTGGTCCAGAAATGCCGCCCCCTCAAGCACAAAACGGAGAGACAGCA
AGCTTGGGAGTGAGACCTTCGATGTGTGTGTCAATCAGATGCTTACATCCAAGGAAATCAAACGTCAGGAGGCCATCTTTGAGCTCTCCCAAGGAGAAGA
AGACTTAATAGAGGACTTGAAATTGGCAAAAAAGGCCTATCATGACCCCATGCTGAAACTCTCCATAATGACAGAACAAGAGTTGAATCAAATTTTTGGA
ACACTGGACTCCTTAATTCCTCTACACGAA---CTCCTTAGTCAGCTTCGAGATGTCCGGAAGCCTGATGGCTCGACTGAACACGTTGGTCCCATTCTCG
TGGGCTGGCTCCCTTGTCTTAGCTCCTATGACAGCTACTGCAGCAATCAAGTAGCTGCCAAGGCTCTGCTGGACCACAAGAAACAAGATCACCGAGTCCA
AGACTTCCTACAGCGATGTTTAGAATCCCCCTTTAGCCGCAAACTAGATCTCTGGAATTTCCTTGATATTCCAAGAAGCCGTCTGGTGAAATACCCTCTG
CTTCTTCGAGAAATCTTGAGGCACACACCGAATGATAATCCAGATCAGCAGCACCTGGAAGAAGCT----------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------AAACTGCATGTTTTCCTCTTCCAAGAAGTGCTTGTGATCACTCGAGCCGTCACCCACAATGAA
CAGCTCTGCTACCAGTTGTACCGACAGCCTATCCCCGTGAAGGACCTCCTGCTGGAAGACCTGCAGGACGGAGAAGTGCGGCTGGGCGGCTCCCTGCGAG
GGGCATTCAGCAACAATGAGAGA---AAAAACTTCTTCAGAGTAAGTTTCAAAAATGGATCCCAAAGTCAGACCCACTCACTGCAGGCCAACGACACCTT
CAACAAACAGCAGTGGCTCAACTGTATTCGTCAAGCCAAAGAGACAGTTTTGTGTGCTGCTGGCCAGGCTGGGGTACTTGACTCTGAGGGACCGTTCCTA
GATCCCGCCACCAGGGGCAGGGAGCTACAAGGAGAAACAAAACTTGAGCAGATGGACCAGTCAGACAGTGAATCAGATTGTAGTATGGACACGAGTGAAG
TCAGCCTAGACTGTGAGCGCATGGAGCAAACAGACTCTTCCTGTGGGAACAGCAGGCATGTTGAAAGCAATGTCTGA


>BGISUSP0000900718
MDSSRVMNQCVFRGMEENKE-PKRQRQNNFPMFPSPKAWNFRGRKRKQSTQDEDAVSLCSLDISEPSNKRVKPLSRVTSLANLIPPVKATPLKRFSQTLQ
RSISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLGSETFDVCVNQMLTSKEIKRQEAIFELSQGEEDLIEDLKLAKKAYHDPMLKLSIMTEQELNQIFG
TLDSLIPLHE-LLSQLRDVRKPDGSTEHVGPILVGWLPCLSSYDSYCSNQVAAKALLDHKKQDHRVQDFLQRCLESPFSRKLDLWNFLDIPRSRLVKYPL
LLREILRHTPNDNPDQQHLEEA---------------------------------------------------------KLHVFLFQEVLVITRAVTHNE
QLCYQLYRQPIPVKDLLLEDLQDGEVRLGGSLRGAFSNNER-KNFFRVSFKNGSQSQTHSLQANDTFNKQQWLNCIRQAKETVLCAAGQAGVLDSEGPFL
DPATRGRELQGETKLEQMDQSDSESDCSMDTSEVSLDCERMEQTDSSCGNSRHVESNV*