Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000189320 (click for geneview)
Transcript ID ENST00000338588(link to ensembl)
Symbol NP_995327.1
Localtion Chromosome:7:134871610:134890702:-1 band: 7q33
Description HWKM1940
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<--------------------------------------------------------------------------><-----------------------
-M--H--W--K--M--L--L--L--L--L--L--Y--Y--N--A--E--A--S--M--C--H--R--W--S--R--A--V--L--F--P--A--A--H--
ATGCATTGGAAGATGTTGCTGCTTCTGCTGTTGTATTACAATGCTGAGGCTTCTATGTGCCACAGGTGGAGCAGGGCTGTGCTCTTCCCTGCCGCCCACC
:::..::::::::.:.::::::::::::::::::.:::..::::: ::::. :: ::: ::::::::::::::::   :::::::::::::: :::::::
ATGTGTTGGAAGACGCTGCTGCTTCTGCTGTTGTGTTATGATGCTCAGGCCACTCTGTCCCACAGGTGGAGCAGG---GTGCTCTTCCCTGCAGCCCACC
-M--C--W--K--T--L--L--L--L--L--L--C--Y--D--A--Q--A--T--L--S--H--R--W--S--R-----V--L--F--P--A--A--H--

----------------------------------------------------------------------------><----------------------
R--P--K--R--S--S--S--L--P--L--N--P--V--L--Q--T--S--L--E--E--V--E--L--L--Y--E--F--L--L--A--E--L--E--I
GGCCAAAGAGGTCCTCATCACTGCCATTGAACCCAGTCCTGCAGACCTCCCTGGAGGAGGTGGAGCTGCTCTACGAGTTCCTGCTGGCCGAACTTGAGAT
::::::::::::::::.::  :::: :::::::: .::::::::: ::::::::::::.::: :.::::::::.::::::::::::::.::::: :::::
GGCCAAAGAGGTCCTCGTCTGTGCCCTTGAACCCCATCCTGCAGAGCTCCCTGGAGGAAGTGCAACTGCTCTATGAGTTCCTGCTGGCTGAACTGGAGAT
R--P--K--R--S--S--S--V--P--L--N--P--I--L--Q--S--S--L--E--E--V--Q--L--L--Y--E--F--L--L--A--E--L--E--I

----------------------------------------------------------------------------------------------------
--S--P--D--L--Q--I--S--I--K--D--E--E--L--A--S--L--R--K--A--S--D--F--R--T--V--C--N--N--V--I--P--K--S-
CAGCCCTGACCTGCAGATCTCCATCAAGGACGAGGAGCTGGCCTCCTTGCGGAAGGCCTCAGACTTCCGCACCGTCTGCAACAACGTCATCCCCAAGAGC
:.::::.:::::: ::::::::::::::::::::::::::::::::.:.::::::::: : :::::::.::::.:::::::..:::: ::::::::::::
CGGCCCCGACCTGAAGATCTCCATCAAGGACGAGGAGCTGGCCTCCCTACGGAAGGCCGCCGACTTCCACACCATCTGCAATGACGTGATCCCCAAGAGC
--G--P--D--L--K--I--S--I--K--D--E--E--L--A--S--L--R--K--A--A--D--F--H--T--I--C--N--D--V--I--P--K--S-

----------------------------------------------------------------------------------------------------
-I--P--D--I--R--R--L--S--A--S--L--S--S--H--P--G--I--L--K--K--E--D--F--E--R--T--V--L--T--L--A--Y--T--
ATCCCAGACATCCGCCGGCTCAGCGCCAGCCTCTCCAGCCACCCTGGCATCCTCAAGAAAGAAGACTTTGAAAGGACAGTGCTGACCCTGGCCTACACAG
:::::.:::::::::::::: :::::::::::::::::::::::.:::.:::::::::::::.:::::.::::::::::..:::::::::::::::    
ATCCCGGACATCCGCCGGCTGAGCGCCAGCCTCTCCAGCCACCCCGGCGTCCTCAAGAAAGAGGACTTCGAAAGGACAGCACTGACCCTGGCCTAC----
-I--P--D--I--R--R--L--S--A--S--L--S--S--H--P--G--V--L--K--K--E--D--F--E--R--T--A--L--T--L--A--Y-----

----------------------------------------------------------------------------------------------------
A--Y--R--T--A--L--S--H--G--H--Q--K--D--I--W--A--Q--S--L--V--S--L--F--Q--A--L--R--H--D--L--M--R--S--S
CCTACCGCACAGCCCTGTCCCACGGCCATCAGAAGGACATCTGGGCGCAGTCCCTCGTTAGCCTCTTCCAGGCCCTGAGGCACGACTTGATGCGCTCCTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------->
--Q--P--G--V--P--P--*-
ACAGCCGGGAGTACCTCCCTGA
                      
----------------------
----------------------

Pig Consensus Sequence

>BGISUST0000887347
ATGTGTTGGAAGACGCTGCTGCTTCTGCTGTTGTGTTATGATGCTCAGGCCACTCTGTCCCACAGGTGGAGCAGG---GTGCTCTTCCCTGCAGCCCACC
GGCCAAAGAGGTCCTCGTCTGTGCCCTTGAACCCCATCCTGCAGAGCTCCCTGGAGGAAGTGCAACTGCTCTATGAGTTCCTGCTGGCTGAACTGGAGAT
CGGCCCCGACCTGAAGATCTCCATCAAGGACGAGGAGCTGGCCTCCCTACGGAAGGCCGCCGACTTCCACACCATCTGCAATGACGTGATCCCCAAGAGC
ATCCCGGACATCCGCCGGCTGAGCGCCAGCCTCTCCAGCCACCCCGGCGTCCTCAAGAAAGAGGACTTCGAAAGGACAGCACTGACCCTGGCCTAC----
----------------------------------------------------------------------------------------------------
----------------------


>BGISUSP0000887347
MCWKTLLLLLLCYDAQATLSHRWSR-VLFPAAHRPKRSSSVPLNPILQSSLEEVQLLYEFLLAELEIGPDLKISIKDEELASLRKAADFHTICNDVIPKS
IPDIRRLSASLSSHPGVLKKEDFERTALTLAY------------------------------------------