Sequences
rtes04_d15r1.y1est
BP157206est
AJ948718est
rfce28c_j6.y1est
rsin01_n9.y1est
rbd_23250.y1reads
rplac_11057.y1est
BF708745est
AJ658034est
reje25b_b24.y1est
rlin22_g1.y1est
BX672470est
BX673003est
rspc015_e7.y1est
rgul0125_h13.y1est
rplac_8576.y1est
rssp31_i4.y1est
AJ747056est
AJ950378est
rnbm06b_m19.y1est
CJ029866est
BX670764est
AJ955549est
rtes22_d9.y1est
dpbxa0_081181.z1reads
AJ939419est
relu1302b_p1.y1est
rfbs3926b_b8.y1est
rste34_l23.y1est
rbyd_4669.y1reads
BI399999est
AJ747115est
rhea02_g23.y1est
BI326920est
CF365346est
rhlv29b_h2.y1est
rlin18_a4.y1est
AJ947854est
rnep31c_a17.y1est
AJ954255est
rfat0128_g18.y1est
rdpbxa0_137851.y1reads
AJ655112est
CT400027reads
rcsp39b_c10.y1est
CV867482est
BX673467est
AJ946822est
bd_23250.z1reads
recc2835c_j4.y1est
rhlv12b_a22.y1est
rste19_c8.y1est
CB477793est
rtra27_b13r1.y1est
BX669320est
reje33b_d6.y1est
rspl03_d14.y1est
rjca29c_f6.y1est
CN028630est
rfce01c_h20.y1est
DV896327est
rlin07_m11r1.y1est
raor013_h23.r1.y1est
reru13c_g22.y1est
rhlv24b_l11.y1est
rsme21_e15.y1est
rspl04_c4.y1est
rpldo0124_e19.y1est
DR082056est
reru29c_e16.y1est
AJ747372est
rese14c_m9.y1est
rhea35_n15.y1est
BF712305est
AJ952961est
rfat0117_p10.y1est
rlyg19_i12.y1est
reje21b_c16.y1est
rrec13_l13.y1est
rssp21_k9.y1est
risp28_i23.y1est
CF175640est
rtra34_e19.y1est
rpan008_m11.y1est
BP158190est
rlyg03_i8.y1est
rspc007_k3.y1est
BW982125est
rdpcxb0_078443.y1reads
BI403675est
risp34_d23.y1est
rdbla0112_j19.y1est
rpldo0105_j1.y1est
rmed21c_k24.y1est
rjca21c_a15.y1est
CX060974est
rlyg18_e23.y1est
recc2824c_k3.y1est
AJ651755est
AJ945343est
rnca26b_b12.y1est
reye1631b_l14r1.y1est
rmgm029_h10.y1est
rgul0117_e17.y1est
rlnt02c_i5.y1est
CA779159est
recc2813c_d4.y1est
rhea09_k8.y1est
rsag06_b3.y1est
rret08_h14.y1est
rjca14c_j5.y1est
rthg16_l14.y1est
rplun0117_f19.y1est
EST Library Info
aor2Aorta
csp2Spleen - RNA from China
dbla3Unavailable
ecc4Foetus 50 days, cortex cerebri
eje6Foetus 50 days, jejunum
eru2Foetus 50 days, regio umbilicalis
ese1Foetus 50 days, M. semitendinosus
eye3Foetus 50 days, Eye
fat2Fatt
fbs3Unavailable
fce2Foetus 100 days, cerebellum
gul3Gullet
hea4Heart
hlv4Heart, left ventricle
isp3M. Infraspinatus
jca3Joint capsule
lin6Large intestine
lnt3Lymphatic nodule tracheobroncalis
lyg4Lymphatic gland
med2Mediastinum
mgm2Mammary gland - 14 days after birth
nbm1Newborn 115 days, bone marrow (pelvis)
nca1Newborn 115 days, cartillage
nep1Newborn 115 days, epidermis
pan1Pancreas
plac4Unavailable
pldo2Unavailable
plun2Unavailable
rec1Rectum
relu2Unavailable
ret1Retina
sag4Salivary gland
sin1Small intestine
sme1M. Semimembranosus
spc2Spinal cord
spl3Spleen
ssp2M. Supraspinatus
ste4M. Semitendinosus
tes3Testes
thg1Thyroid gland
tra2Trachea
Clusters
Oligos
SNPs

Gene ID ENSG00000100664 (click for geneview)
Transcript ID ENST00000338874(link to ensembl)
Symbol EIF5
Localtion Chromosome:14:102870989:102881112:1 band: 14q32.32
Description Eukaryotic translation initiation factor 5 (eIF-5). [Source:Uniprot/SWISSPROT;Acc:P55010]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<----------------------------------------------------------------------><---------------------------
-M--S--V--N--V--N--R--S--V--S--D--Q--F--Y--R--Y--K--M--P--R--L--I--A--K--V--E--G--K--G--N--G--I--K--
ATGTCTGTCAATGTCAACCGCAGCGTGTCAGACCAGTTCTATCGCTACAAGATGCCCCGTCTGATTGCCAAGGTTGAGGGCAAAGGCAATGGAATCAAGA
:::::::::::.::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::.::::::::::: :::::::::::::
ATGTCTGTCAACGTCAACCGCAGCGTGTCAGACCAGTTCTATCGTTACAAGATGCCCCGTCTGATTGCCAAGGTCGAGGGCAAAGGAAATGGAATCAAGA
-M--S--V--N--V--N--R--S--V--S--D--Q--F--Y--R--Y--K--M--P--R--L--I--A--K--V--E--G--K--G--N--G--I--K--

-----------------------------------------------------><---------------------------------------------
T--V--I--V--N--M--V--D--V--A--K--A--L--N--R--P--P--T--Y--P--T--K--Y--F--G--C--E--L--G--A--Q--T--Q--F
CAGTTATAGTCAACATGGTTGACGTTGCAAAGGCGCTTAATCGGCCTCCAACGTATCCCACCAAATATTTTGGTTGTGAGCTGGGAGCACAGACCCAGTT
::::::::::::::::::::::::: :: ::.::::::::::::::::: :::   ::::::::::::::::::::::::::::::::::::::::::::
CAGTTATAGTCAACATGGTTGACGTAGCCAAAGCGCTTAATCGGCCTCCTACG---CCCACCAAATATTTTGGTTGTGAGCTGGGAGCACAGACCCAGTT
T--V--I--V--N--M--V--D--V--A--K--A--L--N--R--P--P--T-----P--T--K--Y--F--G--C--E--L--G--A--Q--T--Q--F

----------------------------------------------------------------------------------------------------
--D--V--K--N--D--R--Y--I--V--N--G--S--H--E--A--N--K--L--Q--D--M--L--D--G--F--I--K--K--F--V--L--C--P-
TGATGTTAAGAATGACCGTTACATTGTCAATGGATCTCATGAGGCGAATAAGCTGCAAGACATGTTGGATGGATTCATTAAAAAATTTGTTCTCTGTCCT
::::::::::::::::.:::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
TGATGTTAAGAATGACTGTTACATTGTCAACGGATCTCATGAGGCGAATAAGCTGCAAGACATGTTGGATGGATTCATTAAAAAATTTGTTCTCTGTCCT
--D--V--K--N--D--C--Y--I--V--N--G--S--H--E--A--N--K--L--Q--D--M--L--D--G--F--I--K--K--F--V--L--C--P-

--------------------------><------------------------------------------------------------------------
-E--C--E--N--P--E--T--D--L--H--V--N--P--K--K--Q--T--I--G--N--S--C--K--A--C--G--Y--R--G--M--L--D--T--
GAATGTGAGAATCCTGAAACAGATTTGCATGTCAATCCAAAGAAGCAAACAATAGGTAATTCTTGTAAAGCCTGTGGCTATCGAGGCATGCTTGACACAC
::.:::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GAGTGTGAGAATCCTGAAACAGATCTGCATGTCAATCCAAAGAAGCAAACAATAGGTAATTCTTGTAAAGCCTGTGGCTATCGAGGCATGCTTGACACAC
-E--C--E--N--P--E--T--D--L--H--V--N--P--K--K--Q--T--I--G--N--S--C--K--A--C--G--Y--R--G--M--L--D--T--

--------------------------------------><------------------------------------------------------------
H--H--K--L--C--T--F--I--L--K--N--P--P--E--N--S--D--S--G--T--G--K--K--E--K--E--K--K--N--R--K--G--K--D
ATCATAAACTCTGCACATTCATTCTCAAAAACCCACCTGAGAATAGTGACAGTGGTACAGGAAAGAAAGAAAAAGAAAAGAAAAACAGAAAGGGCAAAGA
::::::::::::::::::::::::::::::::::::::   ::::::::::::::::::::::::::::::::.:::::::::::::::::::::::.::
ATCATAAACTCTGCACATTCATTCTCAAAAACCCACCT---AATAGTGACAGTGGTACAGGAAAGAAAGAAAAGGAAAAGAAAAACAGAAAGGGCAAGGA
H--H--K--L--C--T--F--I--L--K--N--P--P-----N--S--D--S--G--T--G--K--K--E--K--E--K--K--N--R--K--G--K--D

------------------------------------------------------------------------------------><--------------
--K--E--N--G--S--V--S--S--S--E--T--P--P--P--P--P--P--P--N--E--I--N--P--P--P--H--T--M--E--E--E--E--D-
CAAGGAAAATGGCTCCGTATCCAGCAGTGAGACACCACCACCACCACCACCACCAAATGAAATTAATCCTCCTCCACATACAATGGAAGAAGAGGAGGAT
::::::::::::: ::::.::::::::::::::::::::::::::::::::::::::::::::.:::::.:::::::::.: .::::::::::::::::.
CAAGGAAAATGGCACCGTGTCCAGCAGTGAGACACCACCACCACCACCACCACCAAATGAAATCAATCCCCCTCCACATGCTGTGGAAGAAGAGGAGGAC
--K--E--N--G--T--V--S--S--S--E--T--P--P--P--P--P--P--P--N--E--I--N--P--P--P--H--A--V--E--E--E--E--D-

----------------------------------------------------------------------------------------------------
-D--D--W--G--E--D--T--T--E--E--A--Q--R--R--R--M--D--E--I--S--D--H--A--K--V--L--T--L--S--D--D--L--E--
GATGACTGGGGAGAAGATACAACTGAGGAAGCTCAAAGGCGTCGAATGGATGAAATCAGTGACCATGCAAAAGTTCTGACACTCAGTGATGATTTGGAAA
:::::::::::.::.:::::::: :::::::::::::::::. ::::::::::::::::::::::::::::::::.:.:: :::::::::::::::::::
GATGACTGGGGGGAGGATACAACAGAGGAAGCTCAAAGGCGCAGAATGGATGAAATCAGTGACCATGCAAAAGTTTTAACCCTCAGTGATGATTTGGAAA
-D--D--W--G--E--D--T--T--E--E--A--Q--R--R--R--M--D--E--I--S--D--H--A--K--V--L--T--L--S--D--D--L--E--

-------------------------------------------><-------------------------------------------------------
R--T--I--E--E--R--V--N--I--L--F--D--F--V--K--K--K--K--E--E--G--V--I--D--S--S--D--K--E--I--V--A--E--A
GAACAATTGAGGAGAGGGTCAATATCCTCTTTGATTTTGTTAAGAAAAAGAAAGAAGAGGGTGTTATTGATTCATCTGACAAAGAAATCGTTGCTGAAGC
:::: .::::.::: : :::::::::.: :::::::::::::::::::::::::::::::::.:::::::.:: ::::::::::::::.:: ::::::::
GAACTGTTGAAGAGCGTGTCAATATCTTGTTTGATTTTGTTAAGAAAAAGAAAGAAGAGGGTATTATTGACTCTTCTGACAAAGAAATTGTAGCTGAAGC
R--T--V--E--E--R--V--N--I--L--F--D--F--V--K--K--K--K--E--E--G--I--I--D--S--S--D--K--E--I--V--A--E--A

----------------------------------------------------------------------------------------------------
--E--R--L--D--V--K--A--M--G--P--L--V--L--T--E--V--L--F--N--E--K--I--R--E--Q--I--K--K--Y--R--R--H--F-
AGAAAGACTGGATGTAAAAGCCATGGGCCCTCTTGTTCTAACTGAAGTTCTTTTTAATGAGAAGATTAGAGAACAGATTAAGAAATACAGGCGCCATTTC
:::::::.::::::::::.::::::::::::::::::.:.:::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::
AGAAAGATTGGATGTAAAGGCCATGGGCCCTCTTGTTTTGACTGAAGTTCTTTTTAATGAGAAGATTAGAGAACAAATTAAGAAATACAGGCGCCATTTC
--E--R--L--D--V--K--A--M--G--P--L--V--L--T--E--V--L--F--N--E--K--I--R--E--Q--I--K--K--Y--R--R--H--F-

-----><---------------------------------------------------------------------------------------------
-L--R--F--C--H--N--N--K--K--A--Q--R--Y--L--L--H--G--L--E--C--V--V--A--M--H--Q--A--Q--L--I--S--K--I--
CTACGATTTTGTCACAACAACAAAAAAGCCCAACGGTACCTTCTTCATGGTTTGGAGTGTGTGGTAGCAATGCATCAAGCTCAGCTTATCTCCAAGATTC
.::::::::::.:::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::.::::
TTACGATTTTGCCACAACAACAAAAAAGCTCAACGGTACCTTCTTCATGGTTTGGAGTGTGTGGTAGCAATGCATCAAGCTCAGCTCATCTCCAAAATTC
-L--R--F--C--H--N--N--K--K--A--Q--R--Y--L--L--H--G--L--E--C--V--V--A--M--H--Q--A--Q--L--I--S--K--I--

----------------------------------------------------------------------><----------------------------
P--H--I--L--K--E--M--Y--D--A--D--L--L--E--E--E--V--I--I--S--W--S--E--K--A--S--K--K--Y--V--S--K--E--L
CACATATCTTGAAGGAGATGTACGATGCAGACCTTTTAGAAGAAGAGGTCATCATCAGCTGGTCGGAAAAGGCCTCTAAGAAATATGTCTCCAAAGAACT
:.::::::::::::::::::::.::.:::::::::::.::.:::::.::::::::.:::::::::::::::::.::::::::::::::::: ::::::::
CGCATATCTTGAAGGAGATGTATGACGCAGACCTTTTGGAGGAAGAAGTCATCATTAGCTGGTCGGAAAAGGCTTCTAAGAAATATGTCTCAAAAGAACT
P--H--I--L--K--E--M--Y--D--A--D--L--L--E--E--E--V--I--I--S--W--S--E--K--A--S--K--K--Y--V--S--K--E--L

----------------------------------------------------------------------------------------------------
--A--K--E--I--R--V--K--A--E--P--F--I--K--W--L--K--E--A--E--E--E--S--S--G--G--E--E--E--D--E--D--E--N-
TGCCAAAGAGATTCGTGTCAAAGCAGAACCATTTATAAAATGGTTGAAGGAGGCAGAGGAAGAATCTTCTGGTGGCGAAGAAGAAGATGAAGATGAGAAC
::::::::::::::::::::::::.::::::::::::::::::::::::::.:::::::::::::::::::::::.::::: :: ::::::::::::::.
TGCCAAAGAGATTCGTGTCAAAGCGGAACCATTTATAAAATGGTTGAAGGAAGCAGAGGAAGAATCTTCTGGTGGTGAAGATGATGATGAAGATGAGAAT
--A--K--E--I--R--V--K--A--E--P--F--I--K--W--L--K--E--A--E--E--E--S--S--G--G--E--D--D--D--E--D--E--N-

-----><---------------------------------------------------------------------------------------->
-I--E--V--V--Y--S--K--A--A--S--V--P--K--V--E--T--V--K--S--D--N--K--D--D--D--I--D--I--D--A--I--*-
ATTGAGGTGGTGTATTCGAAGGCTGCCAGTGTACCGAAAGTTGAGACTGTAAAGTCAGACAACAAGGATGACGACATCGATATTGATGCCATTTAA
::.::::::::::::::::::.:::::::.::::::::::::::..::::.::::: ::::::::::::::.:::::.::::::::::::::::::
ATCGAGGTGGTGTATTCGAAGACTGCCAGCGTACCGAAAGTTGAAGCTGTGAAGTCTGACAACAAGGATGATGACATTGATATTGATGCCATTTAA
-I--E--V--V--Y--S--K--T--A--S--V--P--K--V--E--A--V--K--S--D--N--K--D--D--D--I--D--I--D--A--I--*-

Pig Consensus Sequence

>BGISUST0000895899
ATGTCTGTCAACGTCAACCGCAGCGTGTCAGACCAGTTCTATCGTTACAAGATGCCCCGTCTGATTGCCAAGGTCGAGGGCAAAGGAAATGGAATCAAGA
CAGTTATAGTCAACATGGTTGACGTAGCCAAAGCGCTTAATCGGCCTCCTACG---CCCACCAAATATTTTGGTTGTGAGCTGGGAGCACAGACCCAGTT
TGATGTTAAGAATGACTGTTACATTGTCAACGGATCTCATGAGGCGAATAAGCTGCAAGACATGTTGGATGGATTCATTAAAAAATTTGTTCTCTGTCCT
GAGTGTGAGAATCCTGAAACAGATCTGCATGTCAATCCAAAGAAGCAAACAATAGGTAATTCTTGTAAAGCCTGTGGCTATCGAGGCATGCTTGACACAC
ATCATAAACTCTGCACATTCATTCTCAAAAACCCACCT---AATAGTGACAGTGGTACAGGAAAGAAAGAAAAGGAAAAGAAAAACAGAAAGGGCAAGGA
CAAGGAAAATGGCACCGTGTCCAGCAGTGAGACACCACCACCACCACCACCACCAAATGAAATCAATCCCCCTCCACATGCTGTGGAAGAAGAGGAGGAC
GATGACTGGGGGGAGGATACAACAGAGGAAGCTCAAAGGCGCAGAATGGATGAAATCAGTGACCATGCAAAAGTTTTAACCCTCAGTGATGATTTGGAAA
GAACTGTTGAAGAGCGTGTCAATATCTTGTTTGATTTTGTTAAGAAAAAGAAAGAAGAGGGTATTATTGACTCTTCTGACAAAGAAATTGTAGCTGAAGC
AGAAAGATTGGATGTAAAGGCCATGGGCCCTCTTGTTTTGACTGAAGTTCTTTTTAATGAGAAGATTAGAGAACAAATTAAGAAATACAGGCGCCATTTC
TTACGATTTTGCCACAACAACAAAAAAGCTCAACGGTACCTTCTTCATGGTTTGGAGTGTGTGGTAGCAATGCATCAAGCTCAGCTCATCTCCAAAATTC
CGCATATCTTGAAGGAGATGTATGACGCAGACCTTTTGGAGGAAGAAGTCATCATTAGCTGGTCGGAAAAGGCTTCTAAGAAATATGTCTCAAAAGAACT
TGCCAAAGAGATTCGTGTCAAAGCGGAACCATTTATAAAATGGTTGAAGGAAGCAGAGGAAGAATCTTCTGGTGGTGAAGATGATGATGAAGATGAGAAT
ATCGAGGTGGTGTATTCGAAGACTGCCAGCGTACCGAAAGTTGAAGCTGTGAAGTCTGACAACAAGGATGATGACATTGATATTGATGCCATTTAA


>BGISUSP0000895899
MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPT-PTKYFGCELGAQTQFDVKNDCYIVNGSHEANKLQDMLDGFIKKFVLCP
ECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPP-NSDSGTGKKEKEKKNRKGKDKENGTVSSSETPPPPPPPNEINPPPHAVEEEED
DDWGEDTTEEAQRRRMDEISDHAKVLTLSDDLERTVEERVNILFDFVKKKKEEGIIDSSDKEIVAEAERLDVKAMGPLVLTEVLFNEKIREQIKKYRRHF
LRFCHNNKKAQRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEVIISWSEKASKKYVSKELAKEIRVKAEPFIKWLKEAEEESSGGEDDDEDEN
IEVVYSKTASVPKVEAVKSDNKDDDIDIDAI*