Sequences
EST Library Info
fbs1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000172888 (click for geneview)
Transcript ID ENST00000339296(link to ensembl)
Symbol ZNF621
Localtion Chromosome:3:40541373:40550438:1 band: 3p22.1
Description zinc finger protein 621
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<----------------------><---------------------------------------------------------------------------
-M--L--Q--T--T--W--P--Q--E--S--V--T--F--E--D--V--A--V--Y--F--T--Q--N--Q--W--A--S--L--D--P--A--Q--R--
ATGCTCCAAACAACTTGGCCTCAGGAGTCAGTGACCTTTGAGGATGTGGCTGTTTACTTCACCCAGAATCAATGGGCCAGCCTCGACCCTGCGCAGAGGG
                        :::.::::::::::::::::::::::::: ::::::::::::::.::.::::::::::: : ::::::.:::::::
------------------------GAGCCAGTGACCTTTGAGGATGTGGCTGTGTACTTCACCCAGAACCAGTGGGCCAGCCTGGCCCCTGCACAGAGGG
-------------------------E--P--V--T--F--E--D--V--A--V--Y--F--T--Q--N--Q--W--A--S--L--A--P--A--Q--R--

--------------------------------------------------><------------------------------------------------
A--L--Y--G--E--V--M--L--E--N--Y--A--N--V--A--S--L--V--A--F--P--F--P--K--P--A--L--I--S--H--L--E--R--G
CCCTGTACGGGGAGGTGATGCTGGAGAATTATGCAAATGTGGCTTCTCTGGTAGCGTTTCCATTCCCCAAACCTGCTCTGATCTCCCACCTGGAGAGAGG
::::::::.::::::::::::::::::::::::.:::. :..::::..::                                                  
CCCTGTACAGGGAGGTGATGCTGGAGAATTATGTAAACCTAACTTCCTTG--------------------------------------------------
A--L--Y--R--E--V--M--L--E--N--Y--V--N--L--T--S--L---------------------------------------------------

----------------------------------------------------------><----------------------------------------
--E--A--P--W--G--P--D--P--W--D--T--E--I--L--R--G--I--S--Q--G--G--E--S--W--I--K--N--E--G--L--V--I--K-
GGAAGCACCATGGGGCCCAGATCCCTGGGACACCGAGATTCTGAGAGGCATCAGTCAAGGTGGTGAGTCCTGGATCAAAAATGAAGGGCTAGTTATAAAG
                                                             :::::::::::::.:::..  ::::.::.::.:.:::::
-------------------------------------------------------------GGTGAGTCCTGGACCAAGGCAGAAGAGCCAGCTGTAAAG
--------------------------------------------------------------G--E--S--W--T--K--A--E--E--P--A--V--K-

----------------------------------------------------------------------------------------------------
-Q--E--A--S--E--E--T--E--L--H--R--M--P--V--G--G--L--L--R--N--V--S--Q--H--F--D--F--K--R--K--A--L--K--
CAGGAAGCCTCTGAAGAAACAGAGTTGCACAGAATGCCAGTAGGAGGACTTCTCAGGAACGTTTCTCAGCACTTTGATTTTAAAAGGAAGGCACTGAAGC
::::::.::::::::::: :::.::.:::::::::::::::.:::::.::::::::.::.:: ::::::: ::::::: ::::::: :::::: .: .::
CAGGAAACCTCTGAAGAACCAGGGTCGCACAGAATGCCAGTGGGAGGGCTTCTCAGAAATGTGTCTCAGCCCTTTGATATTAAAAGCAAGGCAGCGTGGC
-Q--E--T--S--E--E--P--G--S--H--R--M--P--V--G--G--L--L--R--N--V--S--Q--P--F--D--I--K--S--K--A--A--W--

----------------------------------------------------------------------------------------------------
Q--T--F--N--L--N--P--N--L--I--L--R--G--G--M--K--F--Y--E--C--K--E--C--G--K--I--F--R--Y--N--S--K--L--I
AGACTTTCAATCTAAATCCAAATCTGATACTTCGAGGTGGAATGAAGTTCTATGAATGTAAAGAATGTGGGAAAATCTTCCGATATAACTCAAAGCTTAT
:::::::::.:::.:::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::.::
AGACTTTCAGTCTGAATCCGAATCTGATACTTCGAGGTGGAATGAAGTTCTATGAATGTAAAGAATGTGGGAAAATCTTCAGATATAACTCAAAGCTCAT
Q--T--F--S--L--N--P--N--L--I--L--R--G--G--M--K--F--Y--E--C--K--E--C--G--K--I--F--R--Y--N--S--K--L--I

----------------------------------------------------------------------------------------------------
--R--H--Q--M--S--H--T--G--E--K--P--F--K--C--K--E--C--G--K--A--F--K--S--S--Y--D--C--I--V--H--E--K--N-
TCGGCATCAGATGAGTCATACTGGGGAAAAGCCCTTTAAGTGTAAGGAGTGTGGCAAAGCTTTCAAGTCCAGCTATGATTGTATTGTACATGAGAAAAAC
:::::::::::::::.::.:: :::::.::::::::.::.::::::::.:::::::::::::::::::::::::::::.:::::.::::::::::::::.
TCGGCATCAGATGAGCCACACAGGGGAGAAGCCCTTCAAATGTAAGGAATGTGGCAAAGCTTTCAAGTCCAGCTATGACTGTATCGTACATGAGAAAAAT
--R--H--Q--M--S--H--T--G--E--K--P--F--K--C--K--E--C--G--K--A--F--K--S--S--Y--D--C--I--V--H--E--K--N-

----------------------------------------------------------------------------------------------------
-H--I--G--E--G--P--Y--E--C--K--E--C--G--K--G--L--S--S--N--T--A--L--T--Q--H--Q--R--I--H--T--G--E--K--
CACATTGGAGAAGGGCCCTATGAATGTAAGGAGTGTGGCAAAGGTTTGAGTTCCAACACAGCCTTGACTCAACATCAGAGGATCCACACTGGAGAGAAAC
:::::::: ::::::::::::::.::::::::::::::::::::..:::::::::::::::::::::::::.::::::::::::::::: ::.:::::::
CACATTGGCGAAGGGCCCTATGAGTGTAAGGAGTGTGGCAAAGGCCTGAGTTCCAACACAGCCTTGACTCAGCATCAGAGGATCCACACGGGGGAGAAAC
-H--I--G--E--G--P--Y--E--C--K--E--C--G--K--G--L--S--S--N--T--A--L--T--Q--H--Q--R--I--H--T--G--E--K--

----------------------------------------------------------------------------------------------------
P--Y--E--C--K--E--C--G--K--A--F--R--R--S--A--A--Y--L--Q--H--Q--R--L--H--T--G--E--K--L--Y--K--C--K--E
CCTATGAATGTAAAGAGTGTGGAAAGGCTTTCCGTAGGAGTGCGGCATACCTGCAGCATCAGAGATTACACACGGGAGAGAAACTCTATAAATGTAAGGA
:::::::.:::::.:::::::: ::::::::.::::::::.::.:: ::.:: :::::::::::..:.::::: ::.::::::::::::::.::::::::
CCTATGAGTGTAAGGAGTGTGGCAAGGCTTTTCGTAGGAGCGCAGCCTATCTTCAGCATCAGAGGCTGCACACCGGGGAGAAACTCTATAAGTGTAAGGA
P--Y--E--C--K--E--C--G--K--A--F--R--R--S--A--A--Y--L--Q--H--Q--R--L--H--T--G--E--K--L--Y--K--C--K--E

----------------------------------------------------------------------------------------------------
--C--W--K--A--F--G--C--R--S--L--F--I--V--H--Q--R--I--H--T--G--E--K--P--Y--Q--C--K--E--C--G--K--A--F-
ATGTTGGAAAGCTTTCGGTTGTAGGTCACTTTTTATTGTCCATCAGAGAATTCATACTGGGGAGAAACCTTATCAATGTAAGGAGTGTGGCAAAGCCTTC
::::::::::::::: :: :::::::::::::::::.:::::.:::::::::::.::::::::::::::.::.::.:::::::::::::::::.:: :::
ATGTTGGAAAGCTTTGGGGTGTAGGTCACTTTTTATCGTCCACCAGAGAATTCACACTGGGGAGAAACCCTACCAGTGTAAGGAGTGTGGCAAGGCATTC
--C--W--K--A--L--G--C--R--S--L--F--I--V--H--Q--R--I--H--T--G--E--K--P--Y--Q--C--K--E--C--G--K--A--F-

----------------------------------------------------------------------------------------------------
-T--Q--K--I--A--S--I--Q--H--Q--R--V--H--T--G--E--K--P--Y--E--C--K--V--C--G--K--A--F--K--W--Y--G--S--
ACCCAGAAAATAGCCTCCATTCAGCATCAGAGAGTTCACACTGGGGAGAAGCCTTATGAATGTAAGGTGTGTGGGAAAGCCTTCAAATGGTATGGAAGTT
::::::::.:: ::::::::::::::::::::::::::::::::.:::::::: :::::.::::::::.:::::::::::::::::.:::::::: ::::
ACCCAGAAGATCGCCTCCATTCAGCATCAGAGAGTTCACACTGGAGAGAAGCCGTATGAGTGTAAGGTATGTGGGAAAGCCTTCAAGTGGTATGGCAGTT
-T--Q--K--I--A--S--I--Q--H--Q--R--V--H--T--G--E--K--P--Y--E--C--K--V--C--G--K--A--F--K--W--Y--G--S--

----------------------------------------------------------------------------------------------------
F--V--Q--H--Q--K--L--H--P--V--E--K--K--P--V--K--V--L--G--P--S--L--V--S--P--Q--C--S--S--P--A--I--P--P
TTGTTCAGCATCAGAAATTGCACCCTGTGGAGAAGAAGCCAGTCAAGGTCCTTGGGCCATCCCTGGTCAGTCCCCAGTGCTCCTCTCCAGCCATACCTCC
:::::::::::::::::::::::::..:::::::::::::  .:::::..:::::::..::::::.: ::::::::: ::.::::: ::: . :: ::::
TTGTTCAGCATCAGAAATTGCACCCCATGGAGAAGAAGCCTTCCAAGGCTCTTGGGCTGTCCCTGATGAGTCCCCAGGGCCCCTCTGCAGATTTAGCTCC
F--V--Q--H--Q--K--L--H--P--M--E--K--K--P--S--K--A--L--G--L--S--L--M--S--P--Q--G--P--S--A--D--L--A--P

----------------------------------------------------------------------------------------------------
--V--L--L--Q--G--S--C--S--A--S--A--V--A--V--P--S--L--T--F--P--H--A--V--L--I--P--T--S--G--N--F--F--M-
TGTTCTTCTCCAGGGATCCTGTTCTGCTTCAGCCGTAGCTGTGCCTTCACTGACCTTTCCACATGCTGTGCTCATTCCTACCTCTGGGAATTTTTTCATG
 .: :.:::.::::: .::::.::::::.:::::.:.::::::::.::.:::.::::.:::::.::.:: ::::::::::::::..:.  . : ::::::
GATACCTCTTCAGGGCCCCTGCTCTGCTCCAGCCATGGCTGTGCCCTCGCTGGCCTTCCCACACGCCGTCCTCATTCCTACCTCCAGACCCGTATTCATG
--I--P--L--Q--G--P--C--S--A--P--A--M--A--V--P--S--L--A--F--P--H--A--V--L--I--P--T--S--R--P--V--F--M-

----------------------------------------------------------------------------------------------------
-L--L--P--T--S--G--I--P--S--S--S--A--Q--I--V--R--V--F--Q--G--L--T--P--T--V--K--P--S--P--V--I--L--T--
CTGCTGCCTACATCTGGAATACCTTCTTCATCTGCCCAAATAGTGCGTGTCTTCCAGGGTCTTACTCCCACTGTGAAACCTTCCCCAGTTATTCTCACCC
::::::::..: :::. :.:::::::::: .:::.:::::::::.:: ::::::::::::::: ::::::::::::..:: :::::::::.:.:::::::
CTGCTGCCCGCCTCTACAGTACCTTCTTCTCCTGTCCAAATAGTACGAGTCTTCCAGGGTCTTCCTCCCACTGTGAGGCCATCCCCAGTTGTCCTCACCC
-L--L--P--A--S--T--V--P--S--S--P--V--Q--I--V--R--V--F--Q--G--L--P--P--T--V--R--P--S--P--V--V--L--T--

------------------->
P--S--S--H--S--S--*-
CTTCTTCTCACTCCTCATGA
:::::.:::::.::::.:::
CTTCTCCTCACCCCTCGTGA
P--S--P--H--P--S--*-

Pig Consensus Sequence

>BGISUST0000884654
------------------------GAGCCAGTGACCTTTGAGGATGTGGCTGTGTACTTCACCCAGAACCAGTGGGCCAGCCTGGCCCCTGCACAGAGGG
CCCTGTACAGGGAGGTGATGCTGGAGAATTATGTAAACCTAACTTCCTTG--------------------------------------------------
-------------------------------------------------------------GGTGAGTCCTGGACCAAGGCAGAAGAGCCAGCTGTAAAG
CAGGAAACCTCTGAAGAACCAGGGTCGCACAGAATGCCAGTGGGAGGGCTTCTCAGAAATGTGTCTCAGCCCTTTGATATTAAAAGCAAGGCAGCGTGGC
AGACTTTCAGTCTGAATCCGAATCTGATACTTCGAGGTGGAATGAAGTTCTATGAATGTAAAGAATGTGGGAAAATCTTCAGATATAACTCAAAGCTCAT
TCGGCATCAGATGAGCCACACAGGGGAGAAGCCCTTCAAATGTAAGGAATGTGGCAAAGCTTTCAAGTCCAGCTATGACTGTATCGTACATGAGAAAAAT
CACATTGGCGAAGGGCCCTATGAGTGTAAGGAGTGTGGCAAAGGCCTGAGTTCCAACACAGCCTTGACTCAGCATCAGAGGATCCACACGGGGGAGAAAC
CCTATGAGTGTAAGGAGTGTGGCAAGGCTTTTCGTAGGAGCGCAGCCTATCTTCAGCATCAGAGGCTGCACACCGGGGAGAAACTCTATAAGTGTAAGGA
ATGTTGGAAAGCTTTGGGGTGTAGGTCACTTTTTATCGTCCACCAGAGAATTCACACTGGGGAGAAACCCTACCAGTGTAAGGAGTGTGGCAAGGCATTC
ACCCAGAAGATCGCCTCCATTCAGCATCAGAGAGTTCACACTGGAGAGAAGCCGTATGAGTGTAAGGTATGTGGGAAAGCCTTCAAGTGGTATGGCAGTT
TTGTTCAGCATCAGAAATTGCACCCCATGGAGAAGAAGCCTTCCAAGGCTCTTGGGCTGTCCCTGATGAGTCCCCAGGGCCCCTCTGCAGATTTAGCTCC
GATACCTCTTCAGGGCCCCTGCTCTGCTCCAGCCATGGCTGTGCCCTCGCTGGCCTTCCCACACGCCGTCCTCATTCCTACCTCCAGACCCGTATTCATG
CTGCTGCCCGCCTCTACAGTACCTTCTTCTCCTGTCCAAATAGTACGAGTCTTCCAGGGTCTTCCTCCCACTGTGAGGCCATCCCCAGTTGTCCTCACCC
CTTCTCCTCACCCCTCGTGA


>BGISUSP0000884654
--------EPVTFEDVAVYFTQNQWASLAPAQRALYREVMLENYVNLTSL-------------------------------------GESWTKAEEPAVK
QETSEEPGSHRMPVGGLLRNVSQPFDIKSKAAWQTFSLNPNLILRGGMKFYECKECGKIFRYNSKLIRHQMSHTGEKPFKCKECGKAFKSSYDCIVHEKN
HIGEGPYECKECGKGLSSNTALTQHQRIHTGEKPYECKECGKAFRRSAAYLQHQRLHTGEKLYKCKECWKALGCRSLFIVHQRIHTGEKPYQCKECGKAF
TQKIASIQHQRVHTGEKPYECKVCGKAFKWYGSFVQHQKLHPMEKKPSKALGLSLMSPQGPSADLAPIPLQGPCSAPAMAVPSLAFPHAVLIPTSRPVFM
LLPASTVPSSPVQIVRVFQGLPPTVRPSPVVLTPSPHPS*