Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000106009 (click for geneview)
Transcript ID ENST00000340611(link to ensembl)
Symbol NP_689956.1
Localtion Chromosome:7:2350756:2368569:-1 band: 7p22.3
Description  
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--D--P--E--C--A--Q--L--L--P--A--L--C--A--V--L--V--D--P--R--Q--P--V--A--D--D--T--C--L--E--K--L--L--
ATGGACCCAGAATGCGCCCAGCTGCTCCCGGCTCTCTGTGCTGTTCTGGTAGATCCCAGGCAGCCGGTGGCAGATGACACCTGTTTGGAGAAGCTCCTGG
::::::::.::.::: :::.::: :::::::::::::::::.::.::::.:::.::: ::::::: :::::::::::.::.::.::::::::::: ::::
ATGGACCCGGAGTGCTCCCGGCTCCTCCCGGCTCTCTGTGCCGTCCTGGCAGACCCCCGGCAGCCTGTGGCAGATGATACTTGCTTGGAGAAGCTGCTGG
-M--D--P--E--C--S--R--L--L--P--A--L--C--A--V--L--A--D--P--R--Q--P--V--A--D--D--T--C--L--E--K--L--L--

--------------------------><------------------------------------------------------------------------
D--W--F--K--T--V--T--E--G--E--S--S--V--V--L--L--Q--E--H--P--C--L--V--E--L--L--S--H--V--L--K--V--Q--D
ACTGGTTTAAAACGGTCACTGAAGGAGAGTCCAGTGTCGTGCTGCTGCAGGAGCACCCCTGCCTGGTGGAGCTGCTGTCCCATGTGCTGAAAGTCCAGGA
:::::::::::::..: ::::::      ::::.: :: :: ::::.:::::. :.::::::::::::::::::::::.: :.::::::::: .::::::
ACTGGTTTAAAACAATAACTGAA------TCCAATCTCCTGGTGCTACAGGAAAATCCCTGCCTGGTGGAGCTGCTGTTCGACGTGCTGAAACCCCAGGA
D--W--F--K--T--I--T--E--------S--N--L--L--V--L--Q--E--N--P--C--L--V--E--L--L--F--D--V--L--K--P--Q--D

---------------------------------------------------------------------------------><-----------------
--L--S--S--G--V--L--S--F--S--L--R--L--A--G--T--F--A--A--Q--E--N--C--F--Q--Y--L--Q--Q--G--E--L--L--P-
CCTGAGTTCTGGGGTCCTCTCCTTCTCACTGCGCCTGGCAGGAACCTTCGCAGCCCAGGAAAACTGCTTCCAGTATCTTCAGCAGGGGGAGTTACTACCA
:::::::.:..:.::::::::::::::::: ::::: ::::: :. :::::::::::::::.:::::::::::::.:::::::::::::::::.::.:: 
CCTGAGTCCCAGAGTCCTCTCCTTCTCACTCCGCCTCGCAGGCATGTTCGCAGCCCAGGAAGACTGCTTCCAGTACCTTCAGCAGGGGGAGTTGCTGCCC
--L--S--P--R--V--L--S--F--S--L--R--L--A--G--M--F--A--A--Q--E--D--C--F--Q--Y--L--Q--Q--G--E--L--L--P-

----------------------------------------------------------------------------------------------------
-G--L--F--G--E--P--G--P--L--G--R--A--T--W--A--V--P--T--V--R--S--G--W--I--Q--G--L--R--S--L--A--Q--H--
GGGCTCTTTGGGGAGCCAGGACCCCTCGGCCGAGCAACCTGGGCCGTCCCCACCGTGCGCAGCGGCTGGATCCAGGGCCTGCGCTCCCTGGCACAGCACC
.:::: ::::::::: :.:: ::::: ::  ::::..:::::.: :.::: :::::::::::::::::::::::::::::::::::::::::.:::::::
AGGCTGTTTGGGGAGGCGGGCCCCCTGGGAGGAGCGGCCTGGACGGCCCCGACCGTGCGCAGCGGCTGGATCCAGGGCCTGCGCTCCCTGGCGCAGCACC
-R--L--F--G--E--A--G--P--L--G--G--A--A--W--T--A--P--T--V--R--S--G--W--I--Q--G--L--R--S--L--A--Q--H--

-----------------------------><---------------------------------------------------------------------
P--S--A--L--R--F--L--A--D--H--G--A--V--D--T--I--F--S--L--Q--G--D--S--S--L--F--V--A--S--A--A--S--Q--L
CCAGCGCCCTGCGCTTCCTGGCCGACCATGGTGCGGTCGACACCATCTTCTCCCTGCAGGGAGACTCCAGCCTGTTTGTGGCCTCGGCGGCCAGTCAGCT
:. ::::::::: :::::: ::::::      :: ::.::::::::::::::::::::::::::.:::::::::::::::::::::::.:::.: :::::
CTCGCGCCCTGCCCTTCCTTGCCGAC------GCCGTTGACACCATCTTCTCCCTGCAGGGAGATTCCAGCCTGTTTGTGGCCTCGGCAGCCGGGCAGCT
P--R--A--L--P--F--L--A--D--------A--V--D--T--I--F--S--L--Q--G--D--S--S--L--F--V--A--S--A--A--G--Q--L

----------------------------------------------------------------------------------------------------
--L--V--H--V--L--A--L--S--M--R--G--G--A--E--G--Q--P--C--L--P--G--G--D--W--P--A--C--A--Q--K--I--M--D-
CCTGGTGCACGTCCTGGCTTTGTCCATGCGAGGTGGAGCCGAGGGGCAGCCCTGCCTGCCGGGGGGTGACTGGCCCGCGTGTGCCCAGAAGATCATGGAT
::::::::::.:::::: .::: : ::::::: .  . :: .:::.:: ::: :::.:: :: : ::::: :::: :::::.::::::::::::.:: .:
CCTGGTGCACATCCTGGACTTGGCGATGCGAGCCCCGCCCCGGGGACACCCCGGCCCGCAGGCGTGTGACGGGCCAGCGTGCGCCCAGAAGATCGTGTGT
--L--V--H--I--L--D--L--A--M--R--A--P--P--R--G--H--P--G--P--Q--A--C--D--G--P--A--C--A--Q--K--I--V--C-

----------------------------------------------------------------------------------------------------
-H--V--E--E--S--L--C--S--A--A--T--P--K--V--T--Q--A--L--N--V--L--T--T--T--F--G--R--C--Q--S--P--W--T--
CACGTTGAAGAGTCCTTGTGCTCCGCGGCCACCCCCAAGGTCACTCAGGCCCTGAACGTCCTGACCACGACCTTCGGGCGCTGCCAGAGCCCCTGGACGG
::: :.::::: :::.::.:: ::::.:::.::::  :: :::: ::::: :::::.::::::::::: :: :::::::.::::::              
CACCTCGAAGACTCCCTGCGCGCCGCAGCCGCCCCGCAGCTCACGCAGGC-CTGAATGTCCTGACCACCACGTTCGGGCACTGCCAC-------------
-H--L--E--D--S--L--R--A--A--A--A--P--Q--L--T--Q--A--L--N--V--L--T--T--T--F--G--H--C--H--------------

----------------------------------------------------------------------------------------------------
E--A--L--W--V--R--L--S--P--R--V--A--C--L--L--E--R--D--P--I--P--A--A--H--S--F--V--D--L--L--L--C--V--A
AAGCCCTGTGGGTGCGGCTGAGTCCCCGCGTGGCCTGTCTGCTGGAGAGAGACCCCATCCCCGCCGCACACTCGTTCGTGGACCTGCTTCTCTGTGTGGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----><---------------------------------------------------------------------------------------------
--R--S--P--V--F--S--S--S--D--G--S--L--W--E--T--V--A--R--A--L--S--C--L--G--P--T--H--M--G--P--L--A--L-
TCGTTCTCCCGTGTTCAGTTCTTCCGACGGCAGCCTGTGGGAGACAGTGGCGCGGGCTCTGAGCTGCCTGGGTCCCACCCACATGGGACCCCTGGCTTTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------><-------------------------------------------------------------------------
-G--I--L--K--L--E--H--C--P--Q--A--L--R--T--Q--A--F--Q--V--L--L--Q--P--L--A--C--V--L--K--A--T--V--Q--
GGGATCCTGAAGCTCGAGCACTGTCCACAGGCACTGAGGACCCAGGCCTTCCAGGTCCTTCTCCAGCCCCTGGCCTGTGTCCTGAAGGCCACGGTTCAGG
                        :::::::: .:::::::::::::::.. . :::::.::::::::::::::::::::::::::.::..: :: ::::
------------------------CCACAGGCCTTGAGGACCCAGGCCTCTGGCGTCCTCCTCCAGCCCCTGGCCTGTGTCCTGAAAGCTGCTGTGCAGG
-------------------------P--Q--A--L--R--T--Q--A--S--G--V--L--L--Q--P--L--A--C--V--L--K--A--A--V--Q--

-----------------><---------------------------------------------------------------------------------
A--P--G--P--P--G--L--L--D--G--T--A--D--D--A--T--T--V--D--T--L--L--A--S--K--S--S--C--A--G--L--L--C--R
CCCCCGGACCCCCAGGCTTGCTGGACGGGACGGCAGACGATGCCACGACGGTGGACACACTCCTGGCCTCCAAGTCGTCCTGCGCCGGCCTCCTGTGCCG
 :::::::: ::::                                                                                      
GCCCCGGACGCCCA--------------------------------------------------------------------------------------
G--P--G--R--P---------------------------------------------------------------------------------------

------------------------------------><--------------------------------------------------------------
--T--L--A--H--L--E--E--L--Q--P--L--P--Q--R--P--S--P--W--P--Q--A--S--L--L--G--A--T--V--T--V--L--R--L-
CACCCTGGCTCACCTGGAGGAGCTGCAGCCGCTGCCCCAGCGCCCTTCACCGTGGCCCCAGGCGTCTCTACTGGGGGCTACAGTGACTGTCCTGCGGCTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-C--D--G--S--A--A--P--A--S--S--V--G--G--H--L--C--G--T--L--A--G--C--V--R--V--Q--R--A--A--L--D--F--L--
TGTGACGGCTCGGCTGCCCCTGCCTCCAGTGTGGGGGGCCACCTCTGTGGGACCCTGGCGGGCTGCGTCCGGGTCCAGCGAGCAGCCCTCGACTTCCTGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------><------------------------------------------------------------------------><-
G--T--L--S--Q--G--T--G--P--Q--E--L--V--T--Q--A--L--A--V--L--L--E--C--L--E--S--P--G--S--S--P--T--V--L
GGACGCTGTCACAGGGGACAGGCCCCCAGGAGCTGGTGACGCAGGCGCTTGCTGTCCTCCTGGAGTGCCTCGAGAGCCCCGGCTCCAGCCCCACGGTTCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--K--K--A--F--Q--A--T--L--R--W--L--L--S--S--P--K--T--P--G--C--S--D--L--G--P--L--I--P--Q--F--L--R--E-
GAAGAAGGCCTTCCAGGCCACGCTCAGGTGGCTCCTGAGCTCACCCAAGACCCCCGGCTGCTCTGATCTCGGCCCCCTCATCCCGCAGTTCCTCAGAGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

><------------------------------------------------------------------------------------------------->
-L--F--P--V--L--Q--K--R--L--C--H--P--C--W--E--V--R--D--S--A--L--E--F--L--T--Q--L--S--R--H--W--G--G--
CTGTTCCCTGTGCTGCAGAAACGCCTGTGCCACCCCTGCTGGGAGGTGAGGGACTCCGCCCTCGAGTTCCTGACCCAGCTGAGCAGGCACTGGGGAGGAC
   .::::::::::::::::.::::::::: .:::::::::::::::::::::::: : :::.::::::::::::::: ::. :::.:::::::::    
---CTCCCTGTGCTGCAGAAGCGCCTGTGCAGCCCCTGCTGGGAGGTGAGGGACTCAGGCCTTGAGTTCCTGACCCAGATGGCCAGACACTGGGGA----
----L--P--V--L--Q--K--R--L--C--S--P--C--W--E--V--R--D--S--G--L--E--F--L--T--Q--M--A--R--H--W--G-----

<---------------------------------------------------------------------------------------------------
Q--A--D--F--R--C--A--L--L--A--S--E--V--P--Q--L--A--L--Q--L--L--Q--D--P--E--S--Y--V--R--A--S--A--V--T
AGGCTGACTTCAGATGCGCACTCTTGGCTTCAGAGGTGCCTCAGCTGGCCCTGCAGCTCCTCCAGGACCCTGAGAGTTATGTCCGAGCGAGTGCAGTGAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------------------><--------------------------
--A--M--G--Q--L--S--S--Q--G--L--H--A--P--T--S--P--E--H--A--E--A--R--Q--S--L--F--L--E--L--L--H--I--L-
CGCCATGGGGCAGCTGTCCAGCCAGGGCCTGCACGCCCCCACCAGCCCTGAGCATGCAGAGGCCCGGCAGAGCCTGTTCCTGGAGCTCCTGCACATCCTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-S--V--D--S--E--G--F--P--R--R--A--V--M--Q--V--F--T--E--W--L--R--D--G--H--A--D--A--A--Q--D--T--E--Q--
TCCGTAGACTCGGAGGGCTTCCCACGGCGGGCGGTCATGCAAGTCTTCACTGAGTGGCTGCGGGACGGCCACGCCGACGCGGCCCAGGACACGGAGCAGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
F--V--A--T--V--L--Q--A--A--S--R--D--L--D--W--E--V--R--A--Q--G--L--E--L--A--L--V--F--L--G--Q--T--L--G
TCGTGGCCACTGTGCTGCAGGCGGCGAGCCGAGACCTGGACTGGGAGGTCCGCGCCCAGGGCCTGGAGCTGGCCCTCGTGTTCCTGGGCCAGACTTTGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--P--P--R--T--H--C--P--Y--A--V--A--L--P--E--V--A--P--A--Q--P--L--T--E--A--L--R--A--L--C--H--V--G--L-
GCCGCCGCGTACCCACTGCCCCTATGCCGTGGCCCTACCCGAGGTGGCCCCAGCCCAGCCACTCACCGAGGCACTGAGGGCTCTCTGCCACGTGGGGCTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-F--D--F--A--F--C--A--L--F--D--C--D--R--P--V--A--Q--K--S--C--D--L--L--L--F--L--R--D--K--I--A--S--Y--
TTTGACTTCGCCTTTTGTGCCTTGTTTGACTGCGACCGCCCTGTGGCGCAGAAGTCTTGTGACCTCCTTCTCTTCCTGAGGGACAAGATTGCTTCCTACA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
S--S--L--R--E--A--R--G--S--P--N--T--A--S--A--E--A--T--L--P--R--W--R--A--G--E--Q--A--Q--P--P--G--D--Q
GCAGCCTGCGGGAGGCCAGGGGCAGCCCCAACACTGCCTCCGCAGAGGCCACCCTGCCGAGGTGGCGGGCGGGTGAGCAGGCCCAGCCCCCAGGGGACCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--E--P--E--A--V--L--A--M--L--R--S--L--D--L--E--G--L--R--S--T--L--A--E--S--S--D--H--V--E--K--S--P--Q-
GGAGCCTGAGGCTGTGCTGGCCATGCTCAGGTCCCTAGACCTGGAGGGCCTGCGGAGCACGCTGGCCGAGAGCAGCGACCACGTGGAAAAGAGTCCCCAG
    ::  .: .   : :::::.::::::::::: :.:::.::::.::::: :.:..:::.::::::::::::::.:::::::::::.:.:::.::::::
----CCGCGGCTGTGGGTGGCCGTGCTCAGGTCCATGGACTTGGAAGGCCTTCAGGACACACTGGCCGAGAGCAGTGACCACGTGGAGAGGAGCCCCCAG
-----P--R--L--W--V--A--V--L--R--S--M--D--L--E--G--L--Q--D--T--L--A--E--S--S--D--H--V--E--R--S--P--Q-

------------------------------------------------------------------
-S--L--L--Q--D--M--L--A--T--G--G--F--L--Q--G--D--E--A--D--C--Y--*-
TCCCTCCTGCAGGACATGCTGGCCACGGGAGGCTTCCTGCAGGGGGACGAGGCCGACTGCTACTGA
:: ::::::::::::::::::::::: : .::: ::::  .::.:.:.::::::::::::::::::
TCGCTCCTGCAGGACATGCTGGCCACCGTGGGCGTCCTCGGGGAGAATGAGGCCGACTGCTACTGA
-S--L--L--Q--D--M--L--A--T--V--G--V--L--G--E--N--E--A--D--C--Y--*-

Pig Consensus Sequence

>BGISUST0000891366
ATGGACCCGGAGTGCTCCCGGCTCCTCCCGGCTCTCTGTGCCGTCCTGGCAGACCCCCGGCAGCCTGTGGCAGATGATACTTGCTTGGAGAAGCTGCTGG
ACTGGTTTAAAACAATAACTGAA------TCCAATCTCCTGGTGCTACAGGAAAATCCCTGCCTGGTGGAGCTGCTGTTCGACGTGCTGAAACCCCAGGA
CCTGAGTCCCAGAGTCCTCTCCTTCTCACTCCGCCTCGCAGGCATGTTCGCAGCCCAGGAAGACTGCTTCCAGTACCTTCAGCAGGGGGAGTTGCTGCCC
AGGCTGTTTGGGGAGGCGGGCCCCCTGGGAGGAGCGGCCTGGACGGCCCCGACCGTGCGCAGCGGCTGGATCCAGGGCCTGCGCTCCCTGGCGCAGCACC
CTCGCGCCCTGCCCTTCCTTGCCGAC------GCCGTTGACACCATCTTCTCCCTGCAGGGAGATTCCAGCCTGTTTGTGGCCTCGGCAGCCGGGCAGCT
CCTGGTGCACATCCTGGACTTGGCGATGCGAGCCCCGCCCCGGGGACACCCCGGCCCGCAGGCGTGTGACGGGCCAGCGTGCGCCCAGAAGATCGTGTGT
CACCTCGAAGACTCCCTGCGCGCCGCAGCCGCCCCGCAGCTCACGCAgcTGAATGTCCTGACCACCACGTTCGGGCACTGCCAC----------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------CCACAGGCCTTGAGGACCCAGGCCTCTGGCGTCCTCCTCCAGCCCCTGGCCTGTGTCCTGAAAGCTGCTGTGCAGGGCC
CCGGACGCCCA-----------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
CTCCCTGTGCTGCAGAAGCGCCTGTGCAGCCCCTGCTGGGAGGTGAGGGACTCAGGCCTTGAGTTCCTGACCCAGATGGCCAGACACTGGGGA-------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-CCGCGGCTGTGGGTGGCCGTGCTCAGGTCCATGGACTTGGAAGGCCTTCAGGACACACTGGCCGAGAGCAGTGACCACGTGGAGAGGAGCCCCCAGTCG
CTCCTGCAGGACATGCTGGCCACCGTGGGCGTCCTCGGGGAGAATGAGGCCGACTGCTACTGA


>BGISUSP0000891366
MDPECSRLLPALCAVLADPRQPVADDTCLEKLLDWFKTITE--SNLLVLQENPCLVELLFDVLKPQDLSPRVLSFSLRLAGMFAAQEDCFQYLQQGELLP
RLFGEAGPLGGAAWTAPTVRSGWIQGLRSLAQHPRALPFLAD--AVDTIFSLQGDSSLFVASAAGQLLVHILDLAMRAPPRGHPGPQACDGPACAQKIVC
HLEDSLRAAAAPQLTQLNVLTTTFGHCH------------------------------------------------------------------------
-------PQALRTQASGVLLQPLACVLKAAVQGPGRP---------------------------------------------------------------
----------------------------------------------------------------------------------------------------
LPVLQKRLCSPCWEVRDSGLEFLTQMARHWG---------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------------------------PRLWVAVLRSMDLEGLQDTLAESSDHVERSPQS
LLQDMLATVGVLGENEADCY*