Sequences
EST Library Info
hea1Heart
hyp1Hypothalamus
ski1Skin
tes5Testes
Clusters
Oligos
SNPs

Gene ID ENSG00000034677 (click for geneview)
Transcript ID ENST00000341084(link to ensembl)
Symbol RNF19
Localtion Chromosome:8:101338464:101391503:-1 band: 8q22.2
Description RING finger protein 19 (Dorfin) (Double ring-finger protein) (p38 protein). [Source:Uniprot/SWISSPROT;Acc:Q9NV58]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--Q--E--Q--E--I--G--F--I--S--K--Y--N--E--G--L--C--V--N--T--D--P--V--S--I--L--T--S--I--L--D--M--S--
ATGCAAGAACAAGAAATAGGTTTTATCTCTAAATATAATGAAGGGCTGTGTGTAAACACTGACCCTGTCTCAATTCTAACAAGCATTTTAGACATGAGTT
:::::::::::::::::::::::  ::::::::::::::::::::::::::.::::::: ::::::. :::::::::::..::.::::::::::::::::
ATGCAAGAACAAGAAATAGGTTTGCTCTCTAAATATAATGAAGGGCTGTGTATAAACACAGACCCTAACTCAATTCTAATGAGTATTTTAGACATGAGTT
-M--Q--E--Q--E--I--G--L--L--S--K--Y--N--E--G--L--C--I--N--T--D--P--N--S--I--L--M--S--I--L--D--M--S--

----------------------------------------------------------------------------------------------------
L--H--R--Q--M--G--S--D--R--D--L--Q--S--S--A--S--S--V--S--L--P--S--V--K--K--A--P--K--K--R--R-----I--S
TACATCGGCAAATGGGTTCAGATCGAGATCTTCAGTCCTCTGCTTCATCTGTGAGCTTGCCTTCAGTCAAAAAGGCACCCAAAAAAAGAAGA---ATTTC
:::::::::::::::::::.:::::::::::::::::.::::: ::::::::.::::::::::::::::::::::::::::::::::. :::   :::::
TACATCGGCAAATGGGTTCGGATCGAGATCTTCAGTCTTCTGCATCATCTGTAAGCTTGCCTTCAGTCAAAAAGGCACCCAAAAAAAA-AGAAGAATTTC
L--H--R--Q--M--G--S--D--R--D--L--Q--S--S--A--S--S--V--S--L--P--S--V--K--K--A--P--K--K--R--R--R--I--S

----------------------------------------------------------------------------------------------------
--I--G--S--L--F--R--R--K--K--D--N--K--R--K--S--R--E--L--N--G--G--V--D--G--I--A--S--I--E--S--I--H--S-
AATAGGCTCCCTGTTTCGGAGGAAAAAAGATAACAAACGTAAATCAAGGGAGCTAAATGGCGGGGTGGATGGAATTGCAAGTATTGAAAGTATACATTCT
:::::::::.:: ::::::::::::::.:: :::::::::::::::::::::::::::::::::::::::::::::::.:::::.:::::::::::::::
AATAGGCTCTCTTTTTCGGAGGAAAAAGGAAAACAAACGTAAATCAAGGGAGCTAAATGGCGGGGTGGATGGAATTGCGAGTATCGAAAGTATACATTCT
--I--G--S--L--F--R--R--K--K--E--N--K--R--K--S--R--E--L--N--G--G--V--D--G--I--A--S--I--E--S--I--H--S-

----------------------------------------------------------------------------------------------------
-E--M--C--T--D--K--N--S--I--F-----S--T--N--T--S--S--D--N--G--L--T--S--I--S--K--Q--I--G--D--F--I--E--
GAAATGTGTACTGATAAGAACTCCATTTTC---TCTACAAATACCTCTTCTGACAATGGATTAACTTCCATCAGCAAACAAATTGGAGACTTCATAGAGT
:::::::::::::::::::::::::::::.   ::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::
GAAATGTGTACTGATAAGAACTCCATTTTTT--TCTACAAATACCTCCTCTGACAATGGATTAACTTCCATCAGCAAACAAATTGGAGACTTCATAGAGT
-E--M--C--T--D--K--N--S--I--F--\--S--T--N--T--S--S--D--N--G--L--T--S--I--S--K--Q--I--G--D--F--I--E--

----------------------------------------------------------------------------------------------------
C--P--L--C--L--L--R--H--S--K--D--R--F--P--D--I--M--T--C--H--H--R--S--C--V--D--C--L--R--Q--Y--L--R--I
GCCCTTTGTGCCTTTTGCGGCATTCTAAAGACAGATTTCCTGATATAATGACTTGTCATCACAGATCTTGTGTGGATTGCTTACGACAATATTTAAGGAT
::::.:::::::::::::::::::::::::::::::::::::: :::::::::::::::::.::::::::::::::::::::.::::::::..:::::::
GCCCCTTGTGCCTTTTGCGGCATTCTAAAGACAGATTTCCTGAGATAATGACTTGTCATCATAGATCTTGTGTGGATTGCTTGCGACAATACCTAAGGAT
C--P--L--C--L--L--R--H--S--K--D--R--F--P--E--I--M--T--C--H--H--R--S--C--V--D--C--L--R--Q--Y--L--R--I

----------------------------------------------------------------------------------------------------
--E--I--S--E--S--R--V--N--I--S--C--P--E--C--T--E--R--F--N--P--H--D--I--R--L--I--L--S--D--D--V--L--M-
AGAAATCTCTGAAAGCAGAGTTAATATTAGTTGCCCAGAATGTACTGAACGGTTTAATCCCCATGATATTCGCTTGATATTAAGTGATGATGTCTTGATG
::::::.::::::::.:::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
AGAAATTTCTGAAAGTAGAGTTAATATCAGTTGCCCAGAATGTACTGAACGGTTTAATCCCCATGATATTCGCTTGATATTAAGTGATGATGTCTTGATG
--E--I--S--E--S--R--V--N--I--S--C--P--E--C--T--E--R--F--N--P--H--D--I--R--L--I--L--S--D--D--V--L--M-

----------------------------------------------------------------------------------><----------------
-E--K--Y--E--E--F--M--L--R--R--W--L--V--A--D--P--D--C--R--W--C--P--A--P--D--C--G--Y--A--V--I--A--F--
GAAAAATACGAAGAATTTATGCTTAGACGGTGGCTTGTTGCAGATCCTGATTGTAGGTGGTGTCCAGCTCCAGACTGTGGATATGCTGTGATAGCATTTG
::::::::.::::::::::::::::::::::::                                                                   
GAAAAATATGAAGAATTTATGCTTAGACGGTGG-------------------------------------------------------------------
-E--K--Y--E--E--F--M--L--R--R--W--------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
G--C--A--S--C--P--K--L--T--C--G--R--E--G--C--G--T--E--F--C--Y--H--C--K--Q--I--W--H--P--N--Q--T--C--D
GATGTGCCAGCTGTCCAAAATTAACTTGTGGGCGAGAGGGCTGTGGAACAGAGTTTTGCTACCACTGTAAACAGATTTGGCACCCCAACCAGACCTGTGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------------------------------------><-------
--A--A--R--Q--E--R--A--Q--S--L--R--L--R--T--I--R--S--S--S--I--S--Y--S--Q--E--S--G--A--A--A--D--D--I-
TGCTGCTCGACAAGAGAGAGCCCAGAGCTTACGTTTGAGAACTATACGTTCTTCATCCATTAGTTATAGTCAAGAGTCTGGAGCAGCAGCTGATGATATA
                                                                                           :::::::::
-------------------------------------------------------------------------------------------GATGATATA
--------------------------------------------------------------------------------------------D--D--I-

----------------------------------------------------------------------------------------------------
-K--P--C--P--R--C--A--A--Y--I--I--K--M--N--D--G--S--C--N--H--M--T--C--A--V--C--G--C--E--F--C--W--L--
AAGCCATGTCCACGATGTGCTGCTTATATAATAAAGATGAATGATGGGAGCTGCAATCACATGACATGTGCTGTTTGTGGTTGTGAGTTTTGTTGGTTGT
::::::::::::::::::::::::::::: :::::::::::::::::::::::.::::::::::::::::::::.:::::::::::::::::::::::::
AAGCCATGTCCACGATGTGCTGCTTATAT-ATAAAGATGAATGATGGGAGCTGTAATCACATGACATGTGCTGTCTGTGGTTGTGAGTTTTGTTGGTTGT
-K--P--C--P--R--C--A--A--Y--I--I--K--M--N--D--G--S--C--N--H--M--T--C--A--V--C--G--C--E--F--C--W--L--

---------------------------------------><-----------------------------------------------------------
C--M--K--E--I--S--D--L--H--Y--L--S--P--S--G--C--T--F--W--G--K--K--P--W--S--R--K--K--K--I--L--W--Q--L
GTATGAAAGAAATCTCAGATTTGCATTATCTAAGTCCATCAGGATGTACTTTTTGGGGGAAGAAACCCTGGAGCCGAAAGAAGAAAATATTGTGGCAACT
::::::::::::::::::::::::::::::::   ::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::.::
GTATGAAAGAAATCTCAGATTTGCATTATCTA---CCATCAGGATGTACTTTTTGGGGGAAGAAACCCTGGAGCCGAAAAAAGAAAATATTGTGGCAGCT
C--M--K--E--I--S--D--L--H--Y--L-----P--S--G--C--T--F--W--G--K--K--P--W--S--R--K--K--K--I--L--W--Q--L

----------------------------------------------------------------------------------------------------
--G--T--L--V--G--A--P--V--G--I--A--L--I--A--G--I--A--I--P--A--M--I--I--G--I--P--V--Y--V--G--R--K--I-
GGGAACACTGGTTGGTGCTCCTGTCGGAATCGCTTTAATAGCTGGCATTGCTATTCCTGCAATGATTATTGGCATTCCTGTGTATGTGGGCCGCAAGATT
::::::::: :::::::::::::: :::::.:::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::.::::::
GGGAACACTTGTTGGTGCTCCTGTAGGAATTGCTTTAATAGCTGGCATTGCTATCCCTGCAATGATTATTGGCATTCCTGTGTATGTGGGCCGTAAGATT
--G--T--L--V--G--A--P--V--G--I--A--L--I--A--G--I--A--I--P--A--M--I--I--G--I--P--V--Y--V--G--R--K--I-

--><------------------------------------------------------------------------------------------------
-H--N--R--Y--E--G--K--D--V--S--K--H--K--R--N--L--A--I--A--G--G--V--T--L--S--V--I--V--S--P--V--V--A--
CACAATCGCTATGAAGGCAAGGATGTTTCAAAGCACAAACGGAATTTGGCCATAGCAGGTGGTGTAACGTTGTCTGTAATCGTGTCTCCAGTAGTAGCTG
:::::::: :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::.::::::::.:::::::
CACAATCGATATGAAGGCAAGGATGTTTCAAAGCACAAACGGAATTTGGCCATAGCAGGTGGTGTAACATTGTCTGTAATCGTATCTCCAGTGGTAGCTG
-H--N--R--Y--E--G--K--D--V--S--K--H--K--R--N--L--A--I--A--G--G--V--T--L--S--V--I--V--S--P--V--V--A--

-----------------><---------------------------------------------------------------------------------
A--V--T--V--G--I--G--V--P--I--M--L--A--Y--V--Y--G--V--V--P--I--S--L--C--R--S--G--G--C--G--V--S--A--G
CAGTGACTGTAGGTATCGGTGTTCCTATTATGTTAGCTTATGTCTATGGCGTAGTTCCAATTTCTCTTTGTCGAAGCGGAGGTTGTGGAGTCTCAGCAGG
::::.::::::   ::.:::::::::::::::.::::::::::::::::::: ::::::::::::::.:::::::::::::::::.:::::.::::::::
CAGTAACTGTA---ATTGGTGTTCCTATTATGCTAGCTTATGTCTATGGCGTTGTTCCAATTTCTCTCTGTCGAAGCGGAGGTTGCGGAGTTTCAGCAGG
A--V--T--V-----I--G--V--P--I--M--L--A--Y--V--Y--G--V--V--P--I--S--L--C--R--S--G--G--C--G--V--S--A--G

-------------------------------------------------------------------------------><-------------------
--N--G--K--G--V--R--I--E--F--D--D--E--N--D--I--N--V--G--G--T--N--T--A--V--D--T--T--S--V--A--E-----A-
CAATGGAAAAGGAGTTAGGATTGAATTTGATGATGAAAATGATATAAATGTTGGTGGAACTAACACAGCTGTAGACACAACATCAGTAGCAGAA---GCA
:::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::   ::::: ::::::::::::   :::
CAATGGAAAAGGAGTCAGGATTGAATTTGATGATGAAAATGATATAAATGTTGGTGGAACTAACACAGCTGTA---ACAACTTCAGTAGCAGAAC--GCA
--N--G--K--G--V--R--I--E--F--D--D--E--N--D--I--N--V--G--G--T--N--T--A--V-----T--T--S--V--A--E--\--A-

----------------------------------------------------------------------------------------------------
-R--H--N--P--S--I--G--E--G--S--V--G--G--L--T--G--S--L--S--A--S--G--S--H--M--D--R--I--G--A--I--R--D--
AGACACAACCCAAGCATAGGGGAGGGAAGTGTTGGTGGGCTGACTGGCAGTTTGAGTGCAAGTGGAAGCCACATGGATCGAATAGGAGCCATCCGAGACA
::::::::::: :::::: ::::::::::::::::::: ::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::
AGACACAACCCTAGCATACGGGAGGGAAGTGTTGGTGGTCTGACTGGCAGTTTGAGTGCAAGTGGAAGCCACATGGATCGAATAGGAGCCATCCGGGACA
-R--H--N--P--S--I--R--E--G--S--V--G--G--L--T--G--S--L--S--A--S--G--S--H--M--D--R--I--G--A--I--R--D--

------------------------------------------------------------------------------------------------><--
N--L--S--E--T--A--S--T--M--A--L--A--G--A--S--I--T--G--S--L--S--G--S--A--M--V--N--C--F--N--R--L--E--V
ACCTGAGTGAAACGGCCAGCACCATGGCACTAGCTGGAGCCAGTATAACGGGGAGTCTGTCAGGAAGTGCCATGGTAAACTGTTTTAACAGGTTGGAAGT
:::::::::::::.:::::::::::::::::::::::::::::::::::.::::::.::::::::::.:::::::::::::::::.:::   ::::::::
ACCTGAGTGAAACAGCCAGCACCATGGCACTAGCTGGAGCCAGTATAACAGGGAGTTTGTCAGGAAGCGCCATGGTAAACTGTTTCAAC---TTGGAAGT
N--L--S--E--T--A--S--T--M--A--L--A--G--A--S--I--T--G--S--L--S--G--S--A--M--V--N--C--F--N-----L--E--V

----------------------------------------------------------------------------------------------------
--Q--A--D--V--Q--K--E--R--Y--S--L--S--G--E--S--G--T--V--S--L--G--T--V--S--D--N--A--S--T--K--A--M--A-
ACAAGCAGATGTACAGAAAGAACGGTACAGTCTAAGTGGAGAATCTGGCACAGTCAGCTTGGGAACAGTTAGTGATAATGCCAGCACCAAAGCAATGGCA
::::::::::::::::::::::::::::::::::::::::::::::::::: :::::.::::::::::::::::::::.:::::::::::.:::::::::
ACAAGCAGATGTACAGAAAGAACGGTACAGTCTAAGTGGAGAATCTGGCACTGTCAGTTTGGGAACAGTTAGTGATAACGCCAGCACCAAGGCAATGGCA
--Q--A--D--V--Q--K--E--R--Y--S--L--S--G--E--S--G--T--V--S--L--G--T--V--S--D--N--A--S--T--K--A--M--A-

----------------------------------------><----------------------------------------------------------
-G--S--I--L--N--S--Y--I--P--L--D--K--E--G--N--S--M--E--V--Q--V--D--I--E--S--K--P--S--K--F--R--H--N--
GGATCCATTCTGAATTCCTACATCCCATTGGACAAAGAAGGCAACAGTATGGAGGTGCAAGTAGATATTGAGTCAAAGCCATCCAAATTCAGGCACAACA
:::::::::::.:::::::::::::::::::::   :::::::::::::::::::: ::::::::::::::.::::::::::::::::::::::::::::
GGATCCATTCTAAATTCCTACATCCCATTGGAC---GAAGGCAACAGTATGGAGGTTCAAGTAGATATTGAATCAAAGCCATCCAAATTCAGGCACAACA
-G--S--I--L--N--S--Y--I--P--L--D-----E--G--N--S--M--E--V--Q--V--D--I--E--S--K--P--S--K--F--R--H--N--

----------------------------------------------------------------------------------------------------
S--G--S--S--S--V--D--D--G--S--A--T--R--S--H--A--G--G--S--S--S--G--L--P--E--G--K--S--S--A--T--K--W--S
GTGGAAGCAGTAGTGTGGATGATGGCAGTGCCACCCGAAGTCATGCTGGCGGTTCATCCAGTGGCTTGCCTGAAGGTAAATCTAGTGCCACCAAGTGGTC
::::::::::.:::::.::.:::::::::::..::::::::::: :::: ::::..::..::::.:::::::::::::::::.:::::::::::::::::
GTGGAAGCAGCAGTGTAGACGATGGCAGTGCTGCCCGAAGTCATCCTGGGGGTTTGTCTGGTGGTTTGCCTGAAGGTAAATCCAGTGCCACCAAGTGGTC
S--G--S--S--S--V--D--D--G--S--A--A--R--S--H--P--G--G--L--S--G--G--L--P--E--G--K--S--S--A--T--K--W--S

----------------------------------------------------------------------------------------------------
--K--E--A--T--A--G--K--K--S--K--S--G--K--L--R--K--K--G--N--M--K--I--N--E--T--R--E--D--M--D--A--Q--L-
CAAAGAAGCAACAGCAGGGAAAAAATCAAAAAGTGGTAAACTGAGGAAAAAGGGTAACATGAAGATAAATGAGACGAGAGAGGACATGGATGCACAGTTG
::::::::::::::::::.::.::::::::::::::::::.:::::::::::.:::::::::::::::::::::: ::::::::::::::::::::..::
CAAAGAAGCAACAGCAGGAAAGAAATCAAAAAGTGGTAAATTGAGGAAAAAGAGTAACATGAAGATAAATGAGACCAGAGAGGACATGGATGCACAACTG
--K--E--A--T--A--G--K--K--S--K--S--G--K--L--R--K--K--S--N--M--K--I--N--E--T--R--E--D--M--D--A--Q--L-

----------------------------------------------------------------------------------------------------
-L--E--Q--Q--S--T--N--S--S--E--F--E--A--P--S--L--S--D--S--M--P--S--V--A--D--S--H--S--S--H--F--S--E--
TTAGAACAACAAAGCACGAACTCAAGTGAATTTGAGGCTCCATCCCTCAGTGACAGTATGCCTTCTGTAGCAGATTCTCACTCTAGTCATTTTTCTGAAT
:::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::: ::::::::::::::.::::::::::::::::::::::
TTAGAACAACAAAGCACGAACTCGAGTGAATTTGAGGCTCCATCCCTCAGTGACAGTATGCCATCTGTAGCAGATTCCCACTCTAGTCATTTTTCTGAAT
-L--E--Q--Q--S--T--N--S--S--E--F--E--A--P--S--L--S--D--S--M--P--S--V--A--D--S--H--S--S--H--F--S--E--

----------------------------------------------------------------------------------------------------
F--S--C--S--D--L--E--S--M--K--T--S--C--S--H--G--S--S--D--Y--H--T--R--F--A--T--V--N--I--L--P--E--V--E
TTAGTTGTTCTGACCTAGAAAGCATGAAAACTTCTTGTAGTCATGGTTCCAGTGATTATCACACCCGCTTTGCTACTGTTAACATTCTTCCTGAGGTAGA
::::::::::::::::::::::::::::::::::::::::.:::::::: : :::::::::..:::::::::::::::::::::::::::::::::::::
TTAGTTGTTCTGACCTAGAAAGCATGAAAACTTCTTGTAGCCATGGTTCAACTGATTATCATGCCCGCTTTGCTACTGTTAACATTCTTCCTGAGGTAGA
F--S--C--S--D--L--E--S--M--K--T--S--C--S--H--G--S--T--D--Y--H--A--R--F--A--T--V--N--I--L--P--E--V--E

----------------------------------------------------------------------------------------------------
--N--D--R--L--E--N--S--P--H--Q--C--S--I--S--V--V--T--Q--T--A--S--C--S--E--V--S--Q--L--N--H--I--A--E-
AAATGACCGTCTGGAAAATTCCCCACATCAGTGTAGCATTTCTGTGGTTACCCAAACTGCTTCCTGTTCAGAAGTTTCACAGTTGAATCATATTGCTGAA
:::::::::::::::::::::::::::::::::::::::::::::: ::::. :::::::::: :::::::::: :.:::::::::::::::::::::::
AAATGACCGTCTGGAAAATTCCCCACATCAGTGTAGCATTTCTGTGCTTACTAAAACTGCTTCGTGTTCAGAAGATCCACAGTTGAATCATATTGCTGAA
--N--D--R--L--E--N--S--P--H--Q--C--S--I--S--V--L--T--K--T--A--S--C--S--E--D--P--Q--L--N--H--I--A--E-

----------------------------------------------------------------------------------------------------
-E--H--G--N--N--G--I--K--P--N--V--D--L--Y--F--G--D--A--L--K--E--T--N--N--N--H--S--H--Q--T--M--E--L--
GAACATGGTAACAATGGAATAAAACCTAATGTTGATTTATATTTTGGCGATGCACTAAAAGAAACAAATAACAACCACTCACATCAGACAATGGAATTAA
:::::..:::::::::::::::..::.::::::::::::::::::::..:::::::::::::::::::::::::::::::::::::::::::::::::::
GAACACAGTAACAATGGAATAAGGCCCAATGTTGATTTATATTTTGGTAATGCACTAAAAGAAACAAATAACAACCACTCACATCAGACAATGGAATTAA
-E--H--S--N--N--G--I--R--P--N--V--D--L--Y--F--G--N--A--L--K--E--T--N--N--N--H--S--H--Q--T--M--E--L--

--------------------------
K--V--A--I--Q--T--E--I--*-
AAGTTGCAATTCAGACTGAAATTTAG
::::::::::::::::::: :: :::
AAGTTGCAATTCAGACTGATATATAG
K--V--A--I--Q--T--D--I--*-

Pig Consensus Sequence

>BGISUST0000886677
ATGCAAGAACAAGAAATAGGTTTGCTCTCTAAATATAATGAAGGGCTGTGTATAAACACAGACCCTAACTCAATTCTAATGAGTATTTTAGACATGAGTT
TACATCGGCAAATGGGTTCGGATCGAGATCTTCAGTCTTCTGCATCATCTGTAAGCTTGCCTTCAGTCAAAAAGGCACCCAAAAAaaGAAGAATTTCAAT
AGGCTCTCTTTTTCGGAGGAAAAAGGAAAACAAACGTAAATCAAGGGAGCTAAATGGCGGGGTGGATGGAATTGCGAGTATCGAAAGTATACATTCTGAA
ATGTGTACTGATAAGAACTCCATttTTTCTACAAATACCTCCTCTGACAATGGATTAACTTCCATCAGCAAACAAATTGGAGACTTCATAGAGTGCCCCT
TGTGCCTTTTGCGGCATTCTAAAGACAGATTTCCTGAGATAATGACTTGTCATCATAGATCTTGTGTGGATTGCTTGCGACAATACCTAAGGATAGAAAT
TTCTGAAAGTAGAGTTAATATCAGTTGCCCAGAATGTACTGAACGGTTTAATCCCCATGATATTCGCTTGATATTAAGTGATGATGTCTTGATGGAAAAA
TATGAAGAATTTATGCTTAGACGG----------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------GATGATATAAAGCCATGT
CCACGATGTGCTGCTTAtaTAAAGATGAATGATGGGAGCTGTAATCACATGACATGTGCTGTCTGTGGTTGTGAGTTTTGTTGGTTGTGTATGAAAGAAA
TCTCAGATTTGCATTATCTA---CCATCAGGATGTACTTTTTGGGGGAAGAAACCCTGGAGCCGAAAAAAGAAAATATTGTGGCAGCTGGGAACACTTGT
TGGTGCTCCTGTAGGAATTGCTTTAATAGCTGGCATTGCTATCCCTGCAATGATTATTGGCATTCCTGTGTATGTGGGCCGTAAGATTCACAATCGATAT
GAAGGCAAGGATGTTTCAAAGCACAAACGGAATTTGGCCATAGCAGGTGGTGTAACATTGTCTGTAATCGTATCTCCAGTGGTAGCTGCAGTAACTGTA-
--ATTGGTGTTCCTATTATGCTAGCTTATGTCTATGGCGTTGTTCCAATTTCTCTCTGTCGAAGCGGAGGTTGCGGAGTTTCAGCAGGCAATGGAAAAGG
AGTCAGGATTGAATTTGATGATGAAAATGATATAAATGTTGGTGGAACTAACACAGCTGTA---ACAACTTCAGTAGCAGAagCAAGACACAACCCTAGC
ATACGGGAGGGAAGTGTTGGTGGTCTGACTGGCAGTTTGAGTGCAAGTGGAAGCCACATGGATCGAATAGGAGCCATCCGGGACAACCTGAGTGAAACAG
CCAGCACCATGGCACTAGCTGGAGCCAGTATAACAGGGAGTTTGTCAGGAAGCGCCATGGTAAACTGTTTCAAC---TTGGAAGTACAAGCAGATGTACA
GAAAGAACGGTACAGTCTAAGTGGAGAATCTGGCACTGTCAGTTTGGGAACAGTTAGTGATAACGCCAGCACCAAGGCAATGGCAGGATCCATTCTAAAT
TCCTACATCCCATTGGAC---GAAGGCAACAGTATGGAGGTTCAAGTAGATATTGAATCAAAGCCATCCAAATTCAGGCACAACAGTGGAAGCAGCAGTG
TAGACGATGGCAGTGCTGCCCGAAGTCATCCTGGGGGTTTGTCTGGTGGTTTGCCTGAAGGTAAATCCAGTGCCACCAAGTGGTCCAAAGAAGCAACAGC
AGGAAAGAAATCAAAAAGTGGTAAATTGAGGAAAAAGAGTAACATGAAGATAAATGAGACCAGAGAGGACATGGATGCACAACTGTTAGAACAACAAAGC
ACGAACTCGAGTGAATTTGAGGCTCCATCCCTCAGTGACAGTATGCCATCTGTAGCAGATTCCCACTCTAGTCATTTTTCTGAATTTAGTTGTTCTGACC
TAGAAAGCATGAAAACTTCTTGTAGCCATGGTTCAACTGATTATCATGCCCGCTTTGCTACTGTTAACATTCTTCCTGAGGTAGAAAATGACCGTCTGGA
AAATTCCCCACATCAGTGTAGCATTTCTGTGCTTACTAAAACTGCTTCGTGTTCAGAAGATCCACAGTTGAATCATATTGCTGAAGAACACAGTAACAAT
GGAATAAGGCCCAATGTTGATTTATATTTTGGTAATGCACTAAAAGAAACAAATAACAACCACTCACATCAGACAATGGAATTAAAAGTTGCAATTCAGA
CTGATATATAG


>BGISUSP0000886677
MQEQEIGLLSKYNEGLCINTDPNSILMSILDMSLHRQMGSDRDLQSSASSVSLPSVKKAPKKRRISIGSLFRRKKENKRKSRELNGGVDGIASIESIHSE
MCTDKNSIFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPEIMTCHHRSCVDCLRQYLRIEISESRVNISCPECTERFNPHDIRLILSDDVLMEK
YEEFMLRR--------------------------------------------------------------------------------------DDIKPC
PRCAAYIKMNDGSCNHMTCAVCGCEFCWLCMKEISDLHYL-PSGCTFWGKKPWSRKKKILWQLGTLVGAPVGIALIAGIAIPAMIIGIPVYVGRKIHNRY
EGKDVSKHKRNLAIAGGVTLSVIVSPVVAAVTV-IGVPIMLAYVYGVVPISLCRSGGCGVSAGNGKGVRIEFDDENDINVGGTNTAV-TTSVAEARHNPS
IREGSVGGLTGSLSASGSHMDRIGAIRDNLSETASTMALAGASITGSLSGSAMVNCFN-LEVQADVQKERYSLSGESGTVSLGTVSDNASTKAMAGSILN
SYIPLD-EGNSMEVQVDIESKPSKFRHNSGSSSVDDGSAARSHPGGLSGGLPEGKSSATKWSKEATAGKKSKSGKLRKKSNMKINETREDMDAQLLEQQS
TNSSEFEAPSLSDSMPSVADSHSSHFSEFSCSDLESMKTSCSHGSTDYHARFATVNILPEVENDRLENSPHQCSISVLTKTASCSEDPQLNHIAEEHSNN
GIRPNVDLYFGNALKETNNNHSHQTMELKVAIQTDI*