Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000140009 (click for geneview)
Transcript ID ENST00000341099(link to ensembl)
Symbol ESR2
Localtion Chromosome:14:63769608:63830831:-1 band: 14q23.2
Description Estrogen receptor beta (ER-beta). [Source:Uniprot/SWISSPROT;Acc:Q92731]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--D--I--K--N--S--P--S--S--L--N--S--P--S--S--Y--N--C--S--Q--S--I--L--P--L--E--H--G--S--I--Y--I--P--
ATGGATATAAAAAACTCACCATCTAGCCTTAATTCTCCTTCCTCCTACAACTGCAGTCAATCCATCTTACCCCTGGAGCACGGCTCCATATACATACCTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
S--S--Y--V--D--S--H--H--E--Y--P--A--M--T--F--Y--S--P--A--V--M--N--Y--S--I--P--S--N--V--T--N--L--E--G
CCTCCTATGTAGACAGCCACCATGAATATCCAGCCATGACATTCTATAGCCCTGCTGTGATGAATTACAGCATTCCCAGCAATGTCACTAACTTGGAAGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--G--P--G--R--Q--T--T--S--P--N--V--L--W--P--T--P--G--H--L--S--P--L--V--V--H--R--Q--L--S--H--L--Y--A-
TGGGCCTGGTCGGCAGACCACAAGCCCAAATGTGTTGTGGCCAACACCTGGGCACCTTTCTCCTTTAGTGGTCCATCGCCAGTTATCACATCTGTATGCG
 :::::::::::.:::.:::::::::: :::::::  :::::::: :::::.:::::.::::::::::. .:::::.:::::...:::: :::::::::.
-GGGCCTGGTCGACAGGCCACAAGCCCCAATGTGTG-TGGCCAACTCCTGGACACCTCTCTCCTTTAGCCATCCATTGCCAGCCGTCACTTCTGTATGCA
--G--P--G--R--Q--A--T--S--P--N--V--L--W--P--T--P--G--H--L--S--P--L--A--I--H--C--Q--P--S--L--L--Y--A-

----------------------------------------------------------------><----------------------------------
-E--P--Q--K--S--P--W--C--E--A--R--S--L--E--H--T--L--P--V--N--R--E--T--L--K--R--K--V--S--G--N--R--C--
GAACCTCAAAAGAGTCCCTGGTGTGAAGCAAGATCGCTAGAACACACCTTACCTGTAAACAGAGAGACACTGAAAAGGAAGGTTAGTGGGAACCGTTGCG
:::::::::::::::::.:::::::: .:::::::.::::::::::::::::::::.:::   ::::::.::::::::::::.::::::::.: ::::.:
GAACCTCAAAAGAGTCCTTGGTGTGACACAAGATCACTAGAACACACCTTACCTGTGAAC---GAGACATTGAAAAGGAAGGCTAGTGGGAGCAGTTGTG
-E--P--Q--K--S--P--W--C--D--T--R--S--L--E--H--T--L--P--V--N-----E--T--L--K--R--K--A--S--G--S--S--C--

----------------------------------------------------------------------------------------------------
A--S--P--V--T--G--P--G--S--K--R--D--A--H--F--C--A--V--C--S--D--Y--A--S--G--Y--H--Y--G--V--W--S--C--E
CCAGCCCTGTTACTGGTCCAGGTTCAAAGAGGGATGCTCACTTCTGCGCTGTCTGCAGCGATTACGCATCGGGATATCACTATGGAGTCTGGTCGTGTGA
:::::::::::::..:::::.::::::::::::::::.::::::::.:::::::::::.:::::.::.::.:::::::::::::::::::::::.:::::
CCAGCCCTGTTACCAGTCCAAGTTCAAAGAGGGATGCCCACTTCTGTGCTGTCTGCAGTGATTATGCGTCAGGATATCACTATGGAGTCTGGTCATGTGA
A--S--P--V--T--S--P--S--S--K--R--D--A--H--F--C--A--V--C--S--D--Y--A--S--G--Y--H--Y--G--V--W--S--C--E

-------------------------------------><-------------------------------------------------------------
--G--C--K--A--F--F--K--R--S--I--Q--G--H--N--D--Y--I--C--P--A--T--N--Q--C--T--I--D--K--N--R--R--K--S-
AGGATGTAAGGCCTTTTTTAAAAGAAGCATTCAAGGACATAATGATTATATTTGTCCAGCTACAAATCAGTGTACAATCGATAAAAACCGGCGCAAGAGC
::::::::::::::::::::::::::::::::::                                                                  
AGGATGTAAGGCCTTTTTTAAAAGAAGCATTCAA------------------------------------------------------------------
--G--C--K--A--F--F--K--R--S--I--Q-------------------------------------------------------------------

------------------------------------------------------><--------------------------------------------
-C--Q--A--C--R--L--R--K--C--Y--E--V--G--M--V--K--C--G--S--R--R--E--R--C--G--Y--R--L--V--R--R--Q--R--
TGCCAGGCCTGCCGACTTCGGAAGTGTTACGAAGTGGGAATGGTGAAGTGTGGCTCCCGGAGAGAGAGATGTGGGTACCGCCTTGTGCGGAGACAGAGAA
                                                      :::::::::::. :.:::::::::::: : :::::.:..:::::::
------------------------------------------------------TCCCGGAGAGAACGGTGTGGGTACCGCATAGTGCGAAAGCAGAGAA
-------------------------------------------------------S--R--R--E--R--C--G--Y--R--I--V--R--K--Q--R--

----------------------------------------------------------------------------------------------------
S--A--D--E--Q--L--H--C--A--G--K--A--K--R--S--G--G--H--A--P--R--V--R--E--L--L--L--D--A--L--S--P--E--Q
GTGCCGACGAGCAGCTGCACTGTGCCGGCAAGGCCAAGAGAAGTGGCGGCCACGCGCCCCGAGTGCGGGAGCTGCTGCTGGACGCCCTGAGCCCCGAGCA
.: :.:: :.::: ::::::::. . .:::..:::::::..:.:::.:..:::.:. :::::::: .::::::::: :::..:.:::::::::: :::::
ATTCTGAGGGGCATCTGCACTGCCTGAGCAGAGCCAAGAAGAATGGTGATCACACAACCCGAGTGAAGGAGCTGCTCCTGAGCACCCTGAGCCCAGAGCA
N--S--E--G--H--L--H--C--L--S--R--A--K--K--N--G--D--H--T--T--R--V--K--E--L--L--L--S--T--L--S--P--E--Q

----------------------------------------------------------------------------------------------------
--L--V--L--T--L--L--E--A--E--P--P--H--V--L--I--S--R--P--S--A--P--F--T--E--A--S--M--M--M--S--L--T--K-
GCTAGTGCTCACCCTCCTGGAGGCTGAGCCGCCCCATGTGCTGATCAGCCGCCCCAGTGCGCCCTTCACCGAGGCCTCCATGATGATGTCCCTGACCAAG
:::.:::::::: :::::::::::.:::::.:::::.::::::.: :::::::::::..:::::::::::::::::::::::::::::::::::::::::
GCTGGTGCTCACGCTCCTGGAGGCCGAGCCACCCCACGTGCTGGTGAGCCGCCCCAGCACGCCCTTCACCGAGGCCTCCATGATGATGTCCCTGACCAAG
--L--V--L--T--L--L--E--A--E--P--P--H--V--L--V--S--R--P--S--T--P--F--T--E--A--S--M--M--M--S--L--T--K-

------------------------------------------------------><--------------------------------------------
-L--A--D--K--E--L--V--H--M--I--S--W--A--K--K--I--P--G--F--V--E--L--S--L--F--D--Q--V--R--L--L--E--S--
TTGGCCGACAAGGAGTTGGTACACATGATCAGCTGGGCCAAGAAGATTCCCGGCTTTGTGGAGCTCAGCCTGTTCGACCAAGTGCGGCTCTTGGAGAGCT
.:::::::::::::..::::::::::::::::::::::::::::.:::      ::..::::::::::::::: ::::::::::::::::.:::::::::
CTGGCCGACAAGGAACTGGTACACATGATCAGCTGGGCCAAGAAAATT------TTCATGGAGCTCAGCCTGTACGACCAAGTGCGGCTCCTGGAGAGCT
-L--A--D--K--E--L--V--H--M--I--S--W--A--K--K--I--------F--M--E--L--S--L--Y--D--Q--V--R--L--L--E--S--

---------------------------------------------------------------------------------------------><-----
C--W--M--E--V--L--M--M--G--L--M--W--R--S--I--D--H--P--G--K--L--I--F--A--P--D--L--V--L--D--R--D--E--G
GTTGGATGGAGGTGTTAATGATGGGGCTGATGTGGCGCTCAATTGACCACCCCGGCAAGCTCATCTTTGCTCCAGATCTTGTTCTGGACAGGGATGAGGG
:.::: ::::::::.: :::.::::::::::::::::::: ::.::::::::::::::::::::::::::::::::.::.:::::::::   :::::.::
GCTGGTTGGAGGTGCTCATGGTGGGGCTGATGTGGCGCTCCATCGACCACCCCGGCAAGCTCATCTTTGCTCCAGACCTCGTTCTGGAC---GATGAAGG
C--W--L--E--V--L--M--V--G--L--M--W--R--S--I--D--H--P--G--K--L--I--F--A--P--D--L--V--L--D-----D--E--G

----------------------------------------------------------------------------------------------------
--K--C--V--E--G--I--L--E--I--F--D--M--L--L--A--T--T--S--R--F--R--E--L--K--L--Q--H--K--E--Y--L--C--V-
GAAATGCGTAGAAGGAATTCTGGAAATCTTTGACATGCTCCTGGCAACTACTTCAAGGTTTCGAGAGTTAAAACTCCAACACAAAGAATATCTCTGTGTC
::::::.::::::::::::::::::::::::::::::::::::::::: :::::::::::::: ::::::::::::::::::::.::.::::::::::::
GAAATGTGTAGAAGGAATTCTGGAAATCTTTGACATGCTCCTGGCAACGACTTCAAGGTTTCGTGAGTTAAAACTCCAACACAAGGAGTATCTCTGTGTC
--K--C--V--E--G--I--L--E--I--F--D--M--L--L--A--T--T--S--R--F--R--E--L--K--L--Q--H--K--E--Y--L--C--V-

---------------------------><-----------------------------------------------------------------------
-K--A--M--I--L--L--N--S--S--M--Y--P--L--V--T--A--T--Q--D--A--D--S--S--R--K--L--A--H--L--L--N--A--V--
AAGGCCATGATCCTGCTCAATTCCAGTATGTACCCTCTGGTCACAGCGACCCAGGATGCTGACAGCAGCCGGAAGCTGGCTCACTTGCTGAACGCCGTGA
:::::::::::::: :::::.:::                                                                            
AAGGCCATGATCCTCCTCAACTCC----------------------------------------------------------------------------
-K--A--M--I--L--L--N--S-----------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
T--D--A--L--V--W--V--I--A--K--S--G--I--S--S--Q--Q--Q--S--M--R--L--A--N--L--L--M--L--L--S--H--V--R--H
CCGATGCTTTGGTTTGGGTGATTGCCAAGAGCGGCATCTCCTCCCAGCAGCAATCCATGCGCCTGGCTAACCTCCTGATGCTCCTGTCCCACGTCAGGCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------><------------------------------------------------------------------------------------------
--A--S--N--K--G--M--E--H--L--L--N--M--K--C--K--N--V--V--P--V--Y--D--L--L--L--E--M--L--N--A--H--V--L-
TGCGAGTAACAAGGGCATGGAACATCTGCTCAACATGAAGTGCAAAAATGTGGTCCCAGTGTATGACCTGCTGCTGGAGATGCTGAATGCCCACGTGCTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------------------------------------------------------
-R--G--C--K--S--S--I--T--G--S--E--C--S--P--A--E--D--S--K--S--K--E--G--S--Q--N--P--Q--S--Q--*-
CGCGGGTGCAAGTCCTCCATCACGGGGTCCGAGTGCAGCCCGGCAGAGGACAGTAAAAGCAAAGAGGGCTCCCAGAACCCACAGTCTCAGTGA
                                                                                             
---------------------------------------------------------------------------------------------
---------------------------------------------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000900388
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-GGGCCTGGTCGACAGGCCACAAGCCCCAATGTgtGGCCAACTCCTGGACACCTCTCTCCTTTAGCCATCCATTGCCAGCCGTCACTTCTGTATGCAGAA
CCTCAAAAGAGTCCTTGGTGTGACACAAGATCACTAGAACACACCTTACCTGTGAAC---GAGACATTGAAAAGGAAGGCTAGTGGGAGCAGTTGTGCCA
GCCCTGTTACCAGTCCAAGTTCAAAGAGGGATGCCCACTTCTGTGCTGTCTGCAGTGATTATGCGTCAGGATATCACTATGGAGTCTGGTCATGTGAAGG
ATGTAAGGCCTTTTTTAAAAGAAGCATTCAA---------------------------------------------------------------------
---------------------------------------------------TCCCGGAGAGAACGGTGTGGGTACCGCATAGTGCGAAAGCAGAGAAATT
CTGAGGGGCATCTGCACTGCCTGAGCAGAGCCAAGAAGAATGGTGATCACACAACCCGAGTGAAGGAGCTGCTCCTGAGCACCCTGAGCCCAGAGCAGCT
GGTGCTCACGCTCCTGGAGGCCGAGCCACCCCACGTGCTGGTGAGCCGCCCCAGCACGCCCTTCACCGAGGCCTCCATGATGATGTCCCTGACCAAGCTG
GCCGACAAGGAACTGGTACACATGATCAGCTGGGCCAAGAAAATT------TTCATGGAGCTCAGCCTGTACGACCAAGTGCGGCTCCTGGAGAGCTGCT
GGTTGGAGGTGCTCATGGTGGGGCTGATGTGGCGCTCCATCGACCACCCCGGCAAGCTCATCTTTGCTCCAGACCTCGTTCTGGAC---GATGAAGGGAA
ATGTGTAGAAGGAATTCTGGAAATCTTTGACATGCTCCTGGCAACGACTTCAAGGTTTCGTGAGTTAAAACTCCAACACAAGGAGTATCTCTGTGTCAAG
GCCATGATCCTCCTCAACTCC-------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------------


>BGISUSP0000900388
-------------------------------------------------------------------GPGRQATSPNVWPTPGHLSPLAIHCQPSLLYAE
PQKSPWCDTRSLEHTLPVN-ETLKRKASGSSCASPVTSPSSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQ-----------------------
-----------------SRRERCGYRIVRKQRNSEGHLHCLSRAKKNGDHTTRVKELLLSTLSPEQLVLTLLEAEPPHVLVSRPSTPFTEASMMMSLTKL
ADKELVHMISWAKKI--FMELSLYDQVRLLESCWLEVLMVGLMWRSIDHPGKLIFAPDLVLD-DEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVK
AMILLNS---------------------------------------------------------------------------------------------
------------------------------