Sequences
EST Library Info
csp1Spleen - RNA from China
fbs2Unavailable
pigcb1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000135454 (click for geneview)
Transcript ID ENST00000341156(link to ensembl)
Symbol GALGT
Localtion Chromosome:12:56305945:56313251:-1 band: 12q14.1
Description Beta-1,4 N-acetylgalactosaminyltransferase (EC 2.4.1.92) ((N- acetylneuraminyl)-galactosylglucosylceramide) (GM2/GD2 synthase) (GalNAc-T). [Source:Uniprot/SWISSPROT;Acc:Q00973]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--W--L--G--R--R--A--L--C--A--L--V--L--L--L--A--C--A--S--L--G--L--L--Y--A--S--T--R--D--A--P--G--L--
ATGTGGCTGGGCCGCCGGGCCCTGTGCGCTCTGGTCCTTCTGCTCGCCTGCGCCTCGCTGGGGCTCCTGTACGCGAGCACCCGGGACGCGCCCGGCCTCC
:::.::::::::::::::::::: ::... :::::::: ::::::::::::::::::::::::::::::::.::::::::::::: :::::: :::::::
ATGCGGCTGGGCCGCCGGGCCCTCTGTATGCTGGTCCTGCTGCTCGCCTGCGCCTCGCTGGGGCTCCTGTATGCGAGCACCCGGGTCGCGCCGGGCCTCC
-M--R--L--G--R--R--A--L--C--M--L--V--L--L--L--A--C--A--S--L--G--L--L--Y--A--S--T--R--V--A--P--G--L--

----------------------------------------------------------------------------------------------------
R--L--P--L--A--P--W--A--P--P--Q--S--P--R--R--P--E--L--P--D--L--A--P--E--P--R--Y--A--H--I--P--V--R--I
GGCTACCTCTTGCGCCGTGGGCGCCCCCGCAAAGCCCCCGCAGGCCCGAGCTGCCAGATCTTGCTCCTGAGCCCCGCTACGCACACATCCCGGTCAGGAT
.: .:::::::::::.::::.::::::.:::..::  :: :::::: ::.::.::::.::::::.::.:::::::: ::::::::.::::::::::::::
AGGCACCTCTTGCGCTGTGGACGCCCCTGCAGGGCAACCCCAGGCCAGAACTACCAGGTCTTGCCCCCGAGCCCCGGTACGCACATATCCCGGTCAGGAT
Q--A--P--L--A--L--W--T--P--L--Q--G--N--P--R--P--E--L--P--G--L--A--P--E--P--R--Y--A--H--I--P--V--R--I

-----------------><---------------------------------------------------------------------------------
--K--E--Q--V--V--G--L--L--A--W--N--N--C--S--C--E--S--S--G--G--G--L--P--L--P--F--Q--K--Q--V--R--A--I-
CAAGGAGCAAGTAGTGGGGCTGCTGGCTTGGAACAACTGCAGTTGTGAGTCCAGTGGGGGGGGCCTCCCCCTCCCCTTCCAGAAACAAGTCCGAGCTATT
::::::::::::.:::   :::::. ::: .::.:::::::::::::::::::::::::::.::::.: :.::::::::::::..::.::.:::::.:::
CAAGGAGCAAGTGGTG---CTGCTATCTTCAAATAACTGCAGTTGTGAGTCCAGTGGGGGGAGCCTTCACTTCCCCTTCCAGAGGCAGGTTCGAGCCATT
--K--E--Q--V--V-----L--L--S--S--N--N--C--S--C--E--S--S--G--G--S--L--H--F--P--F--Q--R--Q--V--R--A--I-

----------------------------------------------------------------------------------><----------------
-D--L--T--K--A--F--D--P--A--E--L--R--A--A--S--A--T--R--E--Q--E--F--Q--A--F--L--S--R--S--Q--S--P--A--
GACCTCACCAAGGCCTTTGACCCTGCAGAGCTGAGGGCTGCCTCTGCCACAAGAGAGCAGGAGTTCCAGGCCTTTCTGTCGAGGAGCCAGTCCCCAGCTG
:::.::::::::::::::::::::: .:::::.::::.:::::::::: ::::.::.:::::::::::::::::.::       ::::::::. : ::::
GACTTCACCAAGGCCTTTGACCCTGAGGAGCTAAGGGTTGCCTCTGCCTCAAGGGAACAGGAGTTCCAGGCCTTCCTT------AGCCAGTCTGCTGCTG
-D--F--T--K--A--F--D--P--E--E--L--R--V--A--S--A--S--R--E--Q--E--F--Q--A--F--L--------S--Q--S--A--A--

-----------------------------------------------------------------------------------------><---------
D--Q--L--L--I--A--P--A--N--S--P--L--Q--Y--P--L--Q--G--V--E--V--Q--P--L--R--S--I--L--V--P--G--L--S--L
ACCAGCTGCTCATAGCCCCTGCCAACTCCCCGCTCCAGTACCCCCTACAGGGTGTGGAAGTTCAGCCCCTCAGGAGCATCTTGGTGCCAGGGCTGAGCCT
::::::::::::::::: :::::::::::::::::::.::::::::.:::::::::::.::.:::::::::::::::::::::::::::           
ACCAGCTGCTCATAGCCGCTGCCAACTCCCCGCTCCAATACCCCCTGCAGGGTGTGGAGGTCCAGCCCCTCAGGAGCATCTTGGTGCCA-----------
D--Q--L--L--I--A--A--A--N--S--P--L--Q--Y--P--L--Q--G--V--E--V--Q--P--L--R--S--I--L--V--P------------

------------------------------><--------------------------------------------------------------------
--Q--A--A--S--G--Q--E--V--Y--Q--V--N--L--T--A--S--L--G--T--W--D--V--A--G--E--V--T--G--V--T--L--T--G-
TCAGGCAGCTTCTGGTCAGGAGGTATACCAGGTGAACCTGACTGCCTCCCTAGGCACCTGGGACGTGGCAGGGGAAGTGACTGGAGTTACTCTCACTGGA
                               :::::.:: :::::::::.:.::::::::::::::::::::::::::::: ::::: ::::::::::::
-------------------------------GTGAATCTCACTGCCTCCTTGGGCACCTGGGACGTGGCAGGGGAAGTGACAGGAGTGACTCTCACTGGA
--------------------------------V--N--L--T--A--S--L--G--T--W--D--V--A--G--E--V--T--G--V--T--L--T--G-

----------------------------------------------------------------------------------------------------
-E--G--Q--A--D--L--T--L--V--S--P--G--L--D--Q--L--N--R--Q--L--Q--L--V--T--Y--S--S--R--S--Y--Q--T--N--
GAGGGTCAGGCAGATCTCACCCTTGTCAGCCCAGGGCTGGACCAACTCAACAGGCAACTACAACTGGTCACTTACAGCAGCCGAAGCTACCAGACCAACA
::::: ::: :.:::::::::::.:.::::::::::::::::::::::::. ::::..::::::::.::::.::::::::::::::::::: :.: ::::
GAGGGGCAGCCGGATCTCACCCTCGCCAGCCCAGGGCTGGACCAACTCAATCGGCAGTTACAACTGATCACCTACAGCAGCCGAAGCTACCTGGCAAACA
-E--G--Q--P--D--L--T--L--A--S--P--G--L--D--Q--L--N--R--Q--L--Q--L--I--T--Y--S--S--R--S--Y--L--A--N--

-----------><---------------------------------------------------------------------------------------
T--A--D--T--V--R--F--S--T--E--G--H--E--A--A--F--T--I--R--I--R--H--P--P--N--P--R--L--Y--P--P--G--S--L
CAGCAGACACAGTCCGGTTCTCCACCGAGGGACATGAGGCTGCTTTCACTATCCGCATAAGACACCCGCCCAACCCTCGGCTGTACCCACCTGGGTCTCT
:::::::::::   ::.::::::::::::::::::::.:::::.:::::.::::::::::::::::: ::::.:::: :::::::::::::::::.::::
CAGCAGACACA---CGATTCTCCACCGAGGGACATGAAGCTGCCTTCACCATCCGCATAAGACACCCCCCCAGCCCTAGGCTGTACCCACCTGGGCCTCT
T--A--D--T-----R--F--S--T--E--G--H--E--A--A--F--T--I--R--I--R--H--P--P--S--P--R--L--Y--P--P--G--P--L

----------><----------------------------------------------------------------------------------------
--P--Q--G--A--Q--Y--N--I--S--A--L--V--T--I--A--T--K--T--F--L--R--Y--D--R--L--R--A--L--I--T--S--I--R-
ACCCCAGGGAGCCCAGTACAACATCAGCGCTCTAGTCACGATTGCCACCAAGACCTTCCTCCGTTATGATCGGCTACGGGCTCTCATCACCAGTATCCGC
::::::::::   ::::::::::::::::::::.::::: :: :::::.:::::::::::.:::::..::::::::::::: ::::::.::::.::.:::
ACCCCAGGGA---CAGTACAACATCAGCGCTCTGGTCACCATAGCCACTAAGACCTTCCTTCGTTACAATCGGCTACGGGCACTCATCGCCAGCATTCGC
--P--Q--G-----Q--Y--N--I--S--A--L--V--T--I--A--T--K--T--F--L--R--Y--N--R--L--R--A--L--I--A--S--I--R-

----------------------------------------------------------------------------------------------------
-R--F--Y--P--T--V--T--V--V--I--A--D--D--S--D--K--P--E--R--V--S--G--P--Y--V--E--H--Y--L--M--P--F--G--
CGCTTCTACCCAACGGTTACCGTGGTCATCGCTGACGACAGCGACAAGCCAGAGCGCGTTAGTGGCCCCTACGTGGAACACTATCTCATGCCCTTCGGCA
:::::::::::.:::::.:: :::::::::::.::.:::::::::::::::::::::.::::.::::::.::.: ::.::::::::::::::.::.::::
CGCTTCTACCCGACGGTCACAGTGGTCATCGCCGATGACAGCGACAAGCCAGAGCGCATTAGCGGCCCCCACATCGAGCACTATCTCATGCCTTTTGGCA
-R--F--Y--P--T--V--T--V--V--I--A--D--D--S--D--K--P--E--R--I--S--G--P--H--I--E--H--Y--L--M--P--F--G--

-><-------------------------------------------------------------------------------------------------
K--G--W--F--A--G--R--N--L--A--V--S--Q--V--T--T--K--Y--V--L--W--V--D--D--D--F--V--F--T--A--R--T--R--L
AGGGCTGGTTCGCAGGCCGGAACCTGGCCGTGTCTCAAGTAACCACCAAGTACGTGCTGTGGGTGGACGACGACTTCGTCTTCACGGCGCGGACGCGGCT
::::::::::::: ::::::::::::::.::.::.:::::::::::::::::::::::::::::::::::::::::::::::.:::::::: ::::: ::
AGGGCTGGTTCGCCGGCCGGAACCTGGCTGTATCCCAAGTAACCACCAAGTACGTGCTGTGGGTGGACGACGACTTCGTCTTTACGGCGCGTACGCGCCT
K--G--W--F--A--G--R--N--L--A--V--S--Q--V--T--T--K--Y--V--L--W--V--D--D--D--F--V--F--T--A--R--T--R--L

------------------------------------------><--------------------------------------------------------
--E--R--L--V--D--V--L--E--R--T--P--L--D--L--V--G--G--A--V--R--E--I--S--G--F--A--T--T--Y--R--Q--L--L-
GGAGAGGCTTGTGGACGTGCTGGAGCGGACGCCGCTGGACCTGGTGGGGGGCGCGGTGCGCGAGATCTCCGGCTTTGCCACCACTTATCGGCAGCTGCTG
.::::::::::::::::::::::::::::::::::::::::::   ::::     ::::::::::::::::::::. :::::::.::.::::::::::::
AGAGAGGCTTGTGGACGTGCTGGAGCGGACGCCGCTGGACCTG---GGGGCGCGCGTGCGCGAGATCTCCGGCTTCTCCACCACCTACCGGCAGCTGCTG
--E--R--L--V--D--V--L--E--R--T--P--L--D--L-----G--A--R--V--R--E--I--S--G--F--S--T--T--Y--R--Q--L--L-

----------------------------------------------------------------------------------------------------
-S--V--E--P--G--A--P--G--L--G--N--C--L--R--Q--R--R--G--F--H--H--E--L--V--G--F--P--G--C--V--V--T--D--
AGCGTGGAGCCCGGCGCCCCAGGCCTCGGGAACTGCCTCCGGCAAAGGCGCGGCTTCCACCACGAGCTCGTCGGCTTCCCAGGCTGCGTGGTCACCGACG
:::::::::: :::::: ::::::: :::.:::::.::::::::.::::: :::::::::::::::::::::::::::::::::::::::::::::::::
AGCGTGGAGCGCGGCGCGCCAGGCCGCGGAAACTGTCTCCGGCAGAGGCGAGGCTTCCACCACGAGCTCGTCGGCTTCCCAGGCTGCGTGGTCACCGACG
-S--V--E--R--G--A--P--G--R--G--N--C--L--R--Q--R--R--G--F--H--H--E--L--V--G--F--P--G--C--V--V--T--D--

-----------------------------------------------------------------------------------><---------------
G--V--V--N--F--F--L--A--R--T--D--K--V--R--E--V--G--F--D--P--R--L--S--R--V--A--H--L--E--F--F--L--D--G
GCGTGGTTAACTTCTTCCTGGCGCGGACTGACAAGGTGCGCGAGGTCGGTTTCGACCCCCGCCTCAGCCGCGTGGCTCATCTGGAATTCTTCTTGGATGG
:::::::.::.:::::::::::::: :: :::::::: :::::::::::.::.::::: ::::::::::::::.:: ::..::   ::::::.:::::::
GCGTGGTCAATTTCTTCCTGGCGCGCACGGACAAGGTCCGCGAGGTCGGCTTTGACCCGCGCCTCAGCCGCGTAGCGCACTTG---TTCTTCCTGGATGG
G--V--V--N--F--F--L--A--R--T--D--K--V--R--E--V--G--F--D--P--R--L--S--R--V--A--H--L-----F--F--L--D--G

----------------------------------------------------------------------------------------------------
--L--G--S--L--R--V--G--S--C--S--D--V--V--V--D--H--A--S--K--L--K--L--P--W--T--S--R--D--A--G--A--E--T-
GCTTGGTTCCCTTCGGGTTGGCTCCTGCTCCGACGTCGTGGTGGATCATGCATCCAAACTGAAGCTGCCTTGGACATCAAGGGATGCCGGAGCAGAGACT
.::::::::.::::.::: ::::::::::: ::.::::: ::::::::::: :::::.::::::.::::::::::::::::::::::.::.:::::::::
ACTTGGTTCTCTTCAGGTGGGCTCCTGCTCAGATGTCGTTGTGGATCATGCCTCCAAGCTGAAGTTGCCTTGGACATCAAGGGATGCTGGGGCAGAGACT
--L--G--S--L--Q--V--G--S--C--S--D--V--V--V--D--H--A--S--K--L--K--L--P--W--T--S--R--D--A--G--A--E--T-

----------------------------------------------------------------------------------------------------
-Y--A--R--Y--R--Y--P--G--S--L--D--E--S--Q--M--A--K--H--R--L--L--F--F--K--H--R--L--Q--C--M--T--S--Q--
TACGCCCGGTACCGTTACCCAGGATCACTGGACGAGAGCCAGATGGCCAAACACCGGCTGCTCTTCTTCAAACACCGGCTGCAGTGCATGACCTCCCAGT
::.:::::::::::::::::.::::::.:::::::.: .:::.::::::::::::: ::::::::::::::::::::::: ::::::::::::::  :::
TATGCCCGGTACCGTTACCCGGGATCATTGGACGAAACTCAGGTGGCCAAACACCGCCTGCTCTTCTTCAAACACCGGCTCCAGTGCATGACCTCGGAGT
-Y--A--R--Y--R--Y--P--G--S--L--D--E--T--Q--V--A--K--H--R--L--L--F--F--K--H--R--L--Q--C--M--T--S--E--

->
*-
GA
::
GA
*-

Pig Consensus Sequence

>BGISUST0000877169
ATGCGGCTGGGCCGCCGGGCCCTCTGTATGCTGGTCCTGCTGCTCGCCTGCGCCTCGCTGGGGCTCCTGTATGCGAGCACCCGGGTCGCGCCGGGCCTCC
AGGCACCTCTTGCGCTGTGGACGCCCCTGCAGGGCAACCCCAGGCCAGAACTACCAGGTCTTGCCCCCGAGCCCCGGTACGCACATATCCCGGTCAGGAT
CAAGGAGCAAGTGGTG---CTGCTATCTTCAAATAACTGCAGTTGTGAGTCCAGTGGGGGGAGCCTTCACTTCCCCTTCCAGAGGCAGGTTCGAGCCATT
GACTTCACCAAGGCCTTTGACCCTGAGGAGCTAAGGGTTGCCTCTGCCTCAAGGGAACAGGAGTTCCAGGCCTTCCTT------AGCCAGTCTGCTGCTG
ACCAGCTGCTCATAGCCGCTGCCAACTCCCCGCTCCAATACCCCCTGCAGGGTGTGGAGGTCCAGCCCCTCAGGAGCATCTTGGTGCCA-----------
-------------------------------GTGAATCTCACTGCCTCCTTGGGCACCTGGGACGTGGCAGGGGAAGTGACAGGAGTGACTCTCACTGGA
GAGGGGCAGCCGGATCTCACCCTCGCCAGCCCAGGGCTGGACCAACTCAATCGGCAGTTACAACTGATCACCTACAGCAGCCGAAGCTACCTGGCAAACA
CAGCAGACACA---CGATTCTCCACCGAGGGACATGAAGCTGCCTTCACCATCCGCATAAGACACCCCCCCAGCCCTAGGCTGTACCCACCTGGGCCTCT
ACCCCAGGGA---CAGTACAACATCAGCGCTCTGGTCACCATAGCCACTAAGACCTTCCTTCGTTACAATCGGCTACGGGCACTCATCGCCAGCATTCGC
CGCTTCTACCCGACGGTCACAGTGGTCATCGCCGATGACAGCGACAAGCCAGAGCGCATTAGCGGCCCCCACATCGAGCACTATCTCATGCCTTTTGGCA
AGGGCTGGTTCGCCGGCCGGAACCTGGCTGTATCCCAAGTAACCACCAAGTACGTGCTGTGGGTGGACGACGACTTCGTCTTTACGGCGCGTACGCGCCT
AGAGAGGCTTGTGGACGTGCTGGAGCGGACGCCGCTGGACCTG---GGGGCGCGCGTGCGCGAGATCTCCGGCTTCTCCACCACCTACCGGCAGCTGCTG
AGCGTGGAGCGCGGCGCGCCAGGCCGCGGAAACTGTCTCCGGCAGAGGCGAGGCTTCCACCACGAGCTCGTCGGCTTCCCAGGCTGCGTGGTCACCGACG
GCGTGGTCAATTTCTTCCTGGCGCGCACGGACAAGGTCCGCGAGGTCGGCTTTGACCCGCGCCTCAGCCGCGTAGCGCACTTG---TTCTTCCTGGATGG
ACTTGGTTCTCTTCAGGTGGGCTCCTGCTCAGATGTCGTTGTGGATCATGCCTCCAAGCTGAAGTTGCCTTGGACATCAAGGGATGCTGGGGCAGAGACT
TATGCCCGGTACCGTTACCCGGGATCATTGGACGAAACTCAGGTGGCCAAACACCGCCTGCTCTTCTTCAAACACCGGCTCCAGTGCATGACCTCGGAGT
GA


>BGISUSP0000877169
MRLGRRALCMLVLLLACASLGLLYASTRVAPGLQAPLALWTPLQGNPRPELPGLAPEPRYAHIPVRIKEQVV-LLSSNNCSCESSGGSLHFPFQRQVRAI
DFTKAFDPEELRVASASREQEFQAFL--SQSAADQLLIAAANSPLQYPLQGVEVQPLRSILVP--------------VNLTASLGTWDVAGEVTGVTLTG
EGQPDLTLASPGLDQLNRQLQLITYSSRSYLANTADT-RFSTEGHEAAFTIRIRHPPSPRLYPPGPLPQG-QYNISALVTIATKTFLRYNRLRALIASIR
RFYPTVTVVIADDSDKPERISGPHIEHYLMPFGKGWFAGRNLAVSQVTTKYVLWVDDDFVFTARTRLERLVDVLERTPLDL-GARVREISGFSTTYRQLL
SVERGAPGRGNCLRQRRGFHHELVGFPGCVVTDGVVNFFLARTDKVREVGFDPRLSRVAHL-FFLDGLGSLQVGSCSDVVVDHASKLKLPWTSRDAGAET
YARYRYPGSLDETQVAKHRLLFFKHRLQCMTSE*