Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000050748 (click for geneview)
Transcript ID ENST00000343111(link to ensembl)
Symbol NP_620709.1
Localtion Chromosome:5:179595390:179640216:-1 band: 5q35.3
Description mitogen-activated protein kinase 9 isoform 4
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--D--S--K--C--D--S--Q--F--Y--S--V--Q--V--A--D--S--T--F--T--V--L--K--R--Y--Q--Q--L--K--P--I--G--
ATGAGCGACAGTAAATGTGACAGTCAGTTTTATAGTGTGCAAGTGGCAGACTCAACCTTCACTGTCCTAAAACGTTACCAGCAGCTGAAACCAATTGGCT
:::::.::::::::::::::.:::::::::::.:::::::::::::::::.:::::.:::::::::::::::::::::::::::.:::::::::::::::
ATGAGTGACAGTAAATGTGATAGTCAGTTTTACAGTGTGCAAGTGGCAGATTCAACTTTCACTGTCCTAAAACGTTACCAGCAGTTGAAACCAATTGGCT
-M--S--D--S--K--C--D--S--Q--F--Y--S--V--Q--V--A--D--S--T--F--T--V--L--K--R--Y--Q--Q--L--K--P--I--G--

---------------------><-----------------------------------------------------------------------------
S--G--A--Q--G--I--V--C--A--A--F--D--T--V--L--G--I--N--V--A--V--K--K--L--S--R--P--F--Q--N--Q--T--H--A
CTGGGGCCCAAGGGATTGTTTGTGCTGCATTTGATACAGTTCTTGGGATAAATGTTGCAGTCAAGAAACTAAGCCGTCCTTTTCAGAACCAAACTCATGC
::::.::.:::::.::::::                                                                                
CTGGAGCTCAAGGAATTGTT--------------------------------------------------------------------------------
S--G--A--Q--G--I--V---------------------------------------------------------------------------------

---------------------------------------------------><-----------------------------------------------
--K--R--A--Y--R--E--L--V--L--L--K--C--V--N--H--K--N--I--I--S--L--L--N--V--F--T--P--Q--K--T--L--E--E-
AAAGAGAGCTTATCGTGAACTTGTCCTCTTAAAATGTGTCAATCATAAAAATATAATTAGTTTGTTAAATGTGTTTACACCACAAAAAACTCTAGAAGAA
                                                                      :::::::::::::::::::::.::::::::
----------------------------------------------------------------------GTGTTTACACCACAAAAAACTTTAGAAGAA
-----------------------------------------------------------------------V--F--T--P--Q--K--T--L--E--E-

----------><----------------------------------------------------------------------------------------
-F--Q--D--V--Y--L--V--M--E--L--M--D--A--N--L--C--Q--V--I--H--M--E--L--D--H--E--R--M--S--Y--L--L--Y--
TTTCAAGATGTGTATTTGGTTATGGAATTAATGGATGCTAACTTATGTCAGGTTATTCACATGGAGCTGGATCATGAAAGAATGTCCTACCTTCTTTACC
::.::::::   :::::::::::::::::::::::::::::::::::::::::::::::.::::::.:::::::::::::::::::::::::::::::::
TTCCAAGAT---TATTTGGTTATGGAATTAATGGATGCTAACTTATGTCAGGTTATTCATATGGAGTTGGATCATGAAAGAATGTCCTACCTTCTTTACC
-F--Q--D-----Y--L--V--M--E--L--M--D--A--N--L--C--Q--V--I--H--M--E--L--D--H--E--R--M--S--Y--L--L--Y--

-------------------------------------------------><-------------------------------------------------
Q--M--L--C--G--I--K--H--L--H--S--A--G--I--I--H--R--D--L--K--P--S--N--I--V--V--K--S--D--C--T--L--K--I
AGATGCTTTGTGGTATTAAACATCTGCATTCAGCTGGTATAATTCATAGAGATTTGAAGCCTAGCAACATTGTTGTGAAATCAGACTGCACCCTGAAGAT
:.:::::.::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::: ::.::::::::.:::::::: :::::
AAATGCTCTGTGGTATTAAACATCTGCATTCAGCTGGTATAATTCATAGAGATTTGAAACCTAGCAACATTGTAGTAAAATCAGATTGCACCCTTAAGAT
Q--M--L--C--G--I--K--H--L--H--S--A--G--I--I--H--R--D--L--K--P--S--N--I--V--V--K--S--D--C--T--L--K--I

----------------------------------------------------------------------------------------------------
--L--D--F--G--L--A--R--T--A--C--T--N--F--M--M--T--P--Y--V--V--T--R--Y--Y--R--A--P--E--V--I--L--G--M-
CCTTGACTTTGGCCTGGCCCGGACAGCGTGCACTAACTTCATGATGACCCCTTACGTGGTGACACGGTACTACCGGGCGCCCGAAGTCATCCTGGGTATG
.:::::::::::::::::::: :::::.:::::.:::::.:::::::::::.::.::::::::::::::.::.:::::.:: ::::::::::::::.:::
TCTTGACTTTGGCCTGGCCCGCACAGCATGCACCAACTTTATGATGACCCCCTATGTGGTGACACGGTATTATCGGGCACCAGAAGTCATCCTGGGCATG
--L--D--F--G--L--A--R--T--A--C--T--N--F--M--M--T--P--Y--V--V--T--R--Y--Y--R--A--P--E--V--I--L--G--M-

---------------><----------------------------------------------------------------------><-----------
-G--Y--K--E--N--V--D--I--W--S--V--G--C--I--M--A--E--M--V--L--H--K--V--L--F--P--G--R--D--Y--I--D--Q--
GGCTACAAAGAGAACGTGGACATCTGGTCTGTCGGGTGCATCATGGCAGAAATGGTCCTCCATAAAGTCCTGTTCCCGGGAAGAGACTATATTGATCAGT
:::::.:::::::::   :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::   ::::::::::
GGCTATAAAGAGAAC---GACATCTGGTCTGTCGGGTGCATCATGGCAGAAATGGTCCTCCATAAAGTCCTGTTCCCAGGAAGAGAC---ATTGATCAGT
-G--Y--K--E--N-----D--I--W--S--V--G--C--I--M--A--E--M--V--L--H--K--V--L--F--P--G--R--D-----I--D--Q--

----------------------------------------------------------------------------------------------------
W--N--K--V--I--E--Q--L--G--T--P--S--A--E--F--M--K--K--L--Q--P--T--V--R--N--Y--V--E--N--R--P--K--Y--P
GGAATAAAGTTATTGAGCAGCTGGGAACACCATCAGCAGAGTTCATGAAGAAACTTCAGCCAACTGTGAGGAATTATGTCGAAAACAGACCAAAGTATCC
::::::::::::::::::::::.::::::::::: ::::::::::::::::::::::::::.::::::::::::::::: ::::::::::::::::::::
GGAATAAAGTTATTGAGCAGCTAGGAACACCATCTGCAGAGTTCATGAAGAAACTTCAGCCGACTGTGAGGAATTATGTAGAAAACAGACCAAAGTATCC
W--N--K--V--I--E--Q--L--G--T--P--S--A--E--F--M--K--K--L--Q--P--T--V--R--N--Y--V--E--N--R--P--K--Y--P

----------------------------------------------------------------------><----------------------------
--G--I--K--F--E--E--L--F--P--D--W--I--F--P--S--E--S--E--R--D--K--I--K--T--S--Q--A--R--D--L--L--S--K-
TGGAATCAAATTTGAAGAACTCTTTCCAGATTGGATATTCCCATCAGAATCTGAGCGAGACAAAATAAAAACAAGTCAAGCCAGAGATCTGTTATCAAAA
 :::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::: :::   :::::::::::::: .:.:::::::::
AGGAATCAAATTTGAAGAACTCTTTCCAGATTGGATATTCCCATCAGAATCTGAACGAGACAAAATTAAA---AGTCAAGCCAGAGAATTATTATCAAAA
--G--I--K--F--E--E--L--F--P--D--W--I--F--P--S--E--S--E--R--D--K--I--K-----S--Q--A--R--E--L--L--S--K-

-----------------------------------------------------------------------------------------------><---
-M--L--V--I--D--P--D--K--R--I--S--V--D--E--A--L--R--H--P--Y--I--T--V--W--Y--D--P--A--E--A--E--A--P--
ATGTTAGTGATTGATCCTGACAAGCGGATCTCTGTAGACGAAGCTCTGCGTCACCCATACATCACTGTTTGGTATGACCCCGCCGAAGCAGAAGCCCCAC
::::::::::: :::::::::::.::.:::::::::::.::::::.:::::::::: ::.::.:::::::::::::::::.::.:::::::::   ::::
ATGTTAGTGATAGATCCTGACAAACGAATCTCTGTAGATGAAGCTTTGCGTCACCCTTATATTACTGTTTGGTATGACCCTGCTGAAGCAGAA---CCAC
-M--L--V--I--D--P--D--K--R--I--S--V--D--E--A--L--R--H--P--Y--I--T--V--W--Y--D--P--A--E--A--E-----P--

-----------------------------------------------------------><---------------------------------------
P--P--Q--I--Y--D--A--Q--L--E--E--R--E--H--A--I--E--E--W--K--E--L--I--Y--K--E--V--M--D--W--E--E--R--S
CACCTCAAATTTATGATGCCCAGTTGGAAGAAAGAGAACATGCAATTGAAGAATGGAAAGAGCTAATTTACAAAGAAGTCATGGATTGGGAAGAAAGAAG
:::::::.::::::::::::::::::::::::::::::::::: :::::::::::::::   ::::::::::::::::: :::::::::::::::::::.
CACCTCAGATTTATGATGCCCAGTTGGAAGAAAGAGAACATGCCATTGAAGAATGGAAA---CTAATTTACAAAGAAGTAATGGATTGGGAAGAAAGAAA
P--P--Q--I--Y--D--A--Q--L--E--E--R--E--H--A--I--E--E--W--K-----L--I--Y--K--E--V--M--D--W--E--E--R--N

-------------------------------><-------------------------------------------------------------------
--K--N--G--V--V--K--D--Q--P--S--D--A--A--V--S--S--N--A--T--P--S--Q--S--S--S--I--N--D--I--S--S--M--S-
CAAGAATGGTGTTGTAAAAGATCAGCCTTCAGATGCAGCAGTAAGTAGCAACGCCACTCCTTCTCAGTCTTCATCGATCAATGACATTTCATCCATGTCC
::::::::::::::::::::::::.::::::   :: ::: :::::: :::::::.::::::::::.: .::::: ::::::::::::::::::::::::
CAAGAATGGTGTTGTAAAAGATCAACCTTCA---GCTGCATTAAGTATCAACGCCGCTCCTTCTCAATACTCATCTATCAATGACATTTCATCCATGTCC
--K--N--G--V--V--K--D--Q--P--S-----A--A--L--S--I--N--A--A--P--S--Q--Y--S--S--I--N--D--I--S--S--M--S-

-------------------------------------------------------------------------->
-T--E--Q--T--L--A--S--D--T--D--S--S--L--D--A--S--T--G--P--L--E--G--C--R--*-
ACTGAGCAGACGCTGGCCTCAGACACAGACAGCAGTCTTGATGCCTCGACGGGACCCCTTGAAGGCTGTCGATGA
::::::::::: :::::::::::::::::::::::::: ::::::::.:::::::::::::::::.:::::::::
ACTGAGCAGACCCTGGCCTCAGACACAGACAGCAGTCTGGATGCCTCAACGGGACCCCTTGAAGGTTGTCGATGA
-T--E--Q--T--L--A--S--D--T--D--S--S--L--D--A--S--T--G--P--L--E--G--C--R--*-

Pig Consensus Sequence

>BGISUST0000900088
ATGAGTGACAGTAAATGTGATAGTCAGTTTTACAGTGTGCAAGTGGCAGATTCAACTTTCACTGTCCTAAAACGTTACCAGCAGTTGAAACCAATTGGCT
CTGGAGCTCAAGGAATTGTT--------------------------------------------------------------------------------
----------------------------------------------------------------------GTGTTTACACCACAAAAAACTTTAGAAGAA
TTCCAAGAT---TATTTGGTTATGGAATTAATGGATGCTAACTTATGTCAGGTTATTCATATGGAGTTGGATCATGAAAGAATGTCCTACCTTCTTTACC
AAATGCTCTGTGGTATTAAACATCTGCATTCAGCTGGTATAATTCATAGAGATTTGAAACCTAGCAACATTGTAGTAAAATCAGATTGCACCCTTAAGAT
TCTTGACTTTGGCCTGGCCCGCACAGCATGCACCAACTTTATGATGACCCCCTATGTGGTGACACGGTATTATCGGGCACCAGAAGTCATCCTGGGCATG
GGCTATAAAGAGAAC---GACATCTGGTCTGTCGGGTGCATCATGGCAGAAATGGTCCTCCATAAAGTCCTGTTCCCAGGAAGAGAC---ATTGATCAGT
GGAATAAAGTTATTGAGCAGCTAGGAACACCATCTGCAGAGTTCATGAAGAAACTTCAGCCGACTGTGAGGAATTATGTAGAAAACAGACCAAAGTATCC
AGGAATCAAATTTGAAGAACTCTTTCCAGATTGGATATTCCCATCAGAATCTGAACGAGACAAAATTAAA---AGTCAAGCCAGAGAATTATTATCAAAA
ATGTTAGTGATAGATCCTGACAAACGAATCTCTGTAGATGAAGCTTTGCGTCACCCTTATATTACTGTTTGGTATGACCCTGCTGAAGCAGAA---CCAC
CACCTCAGATTTATGATGCCCAGTTGGAAGAAAGAGAACATGCCATTGAAGAATGGAAA---CTAATTTACAAAGAAGTAATGGATTGGGAAGAAAGAAA
CAAGAATGGTGTTGTAAAAGATCAACCTTCA---GCTGCATTAAGTATCAACGCCGCTCCTTCTCAATACTCATCTATCAATGACATTTCATCCATGTCC
ACTGAGCAGACCCTGGCCTCAGACACAGACAGCAGTCTGGATGCCTCAACGGGACCCCTTGAAGGTTGTCGATGA


>BGISUSP0000900088
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIV--------------------------------------------------VFTPQKTLEE
FQD-YLVMELMDANLCQVIHMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFMMTPYVVTRYYRAPEVILGM
GYKEN-DIWSVGCIMAEMVLHKVLFPGRD-IDQWNKVIEQLGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIK-SQARELLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAE-PPPQIYDAQLEEREHAIEEWK-LIYKEVMDWEERNKNGVVKDQPS-AALSINAAPSQYSSINDISSMS
TEQTLASDTDSSLDASTGPLEGCR*