Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000139514 (click for geneview)
Transcript ID ENST00000343323(link to ensembl)
Symbol SLC7A1
Localtion Chromosome:13:28984117:29067622:-1 band: 13q12.3
Description High-affinity cationic amino acid transporter-1 (CAT-1) (CAT1) (System Y+ basic amino acid transporter) (Ecotropic retroviral leukemia receptor homolog) (ERR) (Ecotropic retrovirus receptor homolog). [Source:Uniprot/SWISSPROT;Acc:P30825]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--G--C--K--V--L--L--N--I--G--Q--Q--M--L--R--R--K--V--V--D--C--S--R--E--E--T--R--L--S--R--C--L--N--
ATGGGGTGCAAAGTCCTGCTCAACATTGGGCAGCAGATGCTGCGGCGGAAGGTGGTGGACTGTAGCCGGGAGGAGACGCGGCTGTCTCGCTGCCTGAACA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
T--F--D--L--V--A--L--G--V--G--S--T--L--G--A--G--V--Y--V--L--A--G--A--V--A--R--E--N--A--G--P--A--I--V
CTTTTGATCTGGTGGCCCTCGGGGTGGGCAGCACACTGGGTGCTGGTGTCTACGTCCTGGCTGGAGCTGTGGCCCGTGAGAATGCAGGCCCTGCCATTGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--I--S--F--L--I--A--A--L--A--S--V--L--A--G--L--C--Y--G--E--F--G--A--R--V--P--K--T--G--S--A--Y--L--Y-
CATCTCCTTCCTGATCGCTGCGCTGGCCTCAGTGCTGGCTGGCCTGTGCTATGGCGAGTTTGGTGCTCGGGTCCCCAAGACGGGCTCAGCTTACCTCTAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------------------------------><-----------------------------
-S--Y--V--T--V--G--E--L--W--A--F--I--T--G--W--N--L--I--L--S--Y--I--I--G--T--S--S--V--A--R--A--W--S--
AGCTATGTCACCGTTGGAGAGCTCTGGGCCTTCATCACCGGCTGGAACTTAATCCTCTCCTACATCATCGGTACTTCAAGCGTAGCGAGGGCCTGGAGCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--T--F--D--E--L--I--G--R--P--I--G--E--F--S--R--T--H--M--T--L--N--A--P--G--V--L--A--E--N--P--D--I--F
CCACCTTCGACGAGCTGATAGGCAGACCCATCGGGGAGTTCTCACGGACACACATGACTCTGAACGCCCCCGGCGTGCTGGCTGAAAACCCCGACATATT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------><----------------------------------------------------------------------
--A--V--I--I--I--L--I--L--T--G--L--L--T--L--G--V--K--E--S--A--M--V--N--K--I--F--T--C--I--N--V--L--V-
CGCAGTGATCATAATTCTCATCTTGACAGGACTTTTAACTCTTGGTGTGAAAGAGTCGGCCATGGTCAACAAAATATTCACTTGTATTAACGTCCTGGTC
                               ::::::::::: ::.:::::::::::.::::::::::::::::::::::: :::::.:::::.::::::
-------------------------------CTTTTAACTCTGGGCGTGAAAGAGTCAGCCATGGTCAACAAAATATTCACGTGTATCAACGTTCTGGTC
--------------------------------L--L--T--L--G--V--K--E--S--A--M--V--N--K--I--F--T--C--I--N--V--L--V-

----------------------------------------------------------------------------------------------------
-L--G--F--I--M--V--S--G--F--V--K--G--S--V--K--N--W--Q--L--T--E--E--D--F--G--N--T--S--G--R--L--C--L--
CTGGGCTTCATAATGGTGTCAGGATTTGTGAAAGGATCGGTTAAAAACTGGCAGCTCACGGAGGAGGATTTTGGGAACACATCAGGCCGTCTCTGTTTGA
:::::::::::::::::::::::::::::::::::::: .:.::::::::::::::::::::::::::.::. ::::::: :: ::.:.::::::..:::
CTGGGCTTCATAATGGTGTCAGGATTTGTGAAAGGATCCATCAAAAACTGGCAGCTCACGGAGGAGGACTTCCGGAACACCTCCGGTCATCTCTGCCTGA
-L--G--F--I--M--V--S--G--F--V--K--G--S--I--K--N--W--Q--L--T--E--E--D--F--R--N--T--S--G--H--L--C--L--

---><-----------------------------------------------------------------------------------------------
N--N--D--T--K--E--G--K--P--G--V--G--G--F--M--P--F--G--F--S--G--V--L--S--G--A--A--T--C--F--Y--A--F--V
ACAATGACACAAAAGAAGGGAAGCCCGGTGTTGGTGGATTCATGCCCTTCGGGTTCTCTGGTGTCCTGTCGGGGGCAGCGACTTGCTTCTATGCCTTCGT
::                                                                                                  
AC--------------------------------------------------------------------------------------------------
N---------------------------------------------------------------------------------------------------

-------------------------><-------------------------------------------------------------------------
--G--F--D--C--I--A--T--T--G--E--E--V--K--N--P--Q--K--A--I--P--V--G--I--V--A--S--L--L--I--C--F--I--A-
GGGCTTTGACTGCATCGCCACCACAGGTGAAGAGGTGAAGAACCCACAGAAGGCCATCCCCGTGGGGATCGTGGCGTCCCTCTTGATCTGCTTCATCGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-Y--F--G--V--S--A--A--L--T--L--M--M--P--Y--F--C--L--D--N--N--S--P--L--P--D--A--F--K--H--V--G--W--E--
TACTTTGGGGTGTCGGCTGCCCTCACGCTCATGATGCCCTACTTCTGCCTGGACAATAACAGCCCCCTGCCCGACGCCTTTAAGCACGTGGGCTGGGAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------><--------------------------------------------------
G--A--K--Y--A--V--A--V--G--S--L--C--A--L--S--A--S--L--L--G--S--M--F--P--M--P--R--V--I--Y--A--M--A--E
GTGCCAAGTACGCAGTGGCCGTGGGCTCCCTCTGCGCTCTTTCCGCCAGTCTTCTAGGTTCCATGTTTCCCATGCCTCGGGTTATCTATGCCATGGCTGA
                                                                                ::::::::::::::::::::
--------------------------------------------------------------------------------GTTATCTATGCCATGGCTGA
---------------------------------------------------------------------------------V--I--Y--A--M--A--E

----------------------------------------------------------------------------------------><----------
--D--G--L--L--F--K--F--L--A--N--V--N--D--R--T--K--T--P--I--I--A--T--L--A--S--G--A--V--A--A--V--M--A-
GGATGGACTGCTATTTAAATTCTTAGCCAACGTCAATGATAGGACCAAAACACCAATAATCGCCACATTAGCCTCGGGTGCCGTTGCTGCTGTGATGGCC
.::.::.:::::.:::::.::.::.::::: .::::.::. :::::::::::::::::::::::::.:::::::::::.:::.::      :: ::::::
AGACGGGCTGCTGTTTAAGTTTTTGGCCAAGATCAACGACCGGACCAAAACACCAATAATCGCCACGTTAGCCTCGGGCGCCATT------GTCATGGCC
--D--G--L--L--F--K--F--L--A--K--I--N--D--R--T--K--T--P--I--I--A--T--L--A--S--G--A--I--------V--M--A-

-------------------------------------------------------------------------------------------><-------
-F--L--F--D--L--K--D--L--V--D--L--M--S--I--G--T--L--L--A--Y--S--L--V--A--A--C--V--L--V--L--R--Y--Q--
TTCCTCTTTGACCTGAAGGACTTGGTGGACCTCATGTCCATTGGCACTCTCCTGGCTTACTCGTTGGTGGCTGCCTGTGTGTTGGTCTTACGGTACCAGC
::::::::::::::::::::::::::::::::::::::::::::::: :::::::: ::::::::::::::.::::::::::::::::::   :::::::
TTCCTCTTTGACCTGAAGGACTTGGTGGACCTCATGTCCATTGGCACGCTCCTGGCGTACTCGTTGGTGGCCGCCTGTGTGTTGGTCTTA---TACCAGC
-F--L--F--D--L--K--D--L--V--D--L--M--S--I--G--T--L--L--A--Y--S--L--V--A--A--C--V--L--V--L-----Y--Q--

----------------------------------------------------------------------------------------------------
P--E--Q--P--N--L--V--Y--Q--M--A--S--T--S--D--E--L--D--P--A--D--Q--N--E--L--A--S--T--N--D--S--Q--L--G
CAGAGCAGCCTAACCTGGTATACCAGATGGCCAGTACTTCCGACGAGTTAGATCCAGCAGACCAAAATGAATTGGCAAGCACCAATGATTCCCAGCTGGG
:.:::::::: ::: ::::.:::::::::::: : ::.  :::::::.:.::.:: :..:::::.::.::..:::..:::::::..::::::::: .:::
CGGAGCAGCCGAACATGGTGTACCAGATGGCCCGAACCAGCGACGAGCTGGACCCCGTGGACCAGAACGAGCTGGTGAGCACCAGCGATTCCCAGACGGG
P--E--Q--P--N--M--V--Y--Q--M--A--R--T--S--D--E--L--D--P--V--D--Q--N--E--L--V--S--T--S--D--S--Q--T--G

----------------------------------------------------------------------------------------------------
--F--L--P--E--A--E--M--F--S--L--K--T--I--L--S--P--K--N--M--E--P--S--K--I--S--G--L--I--V--N--I--S--T-
CTTTTTACCAGAGGCAGAGATGTTCTCTTTGAAAACCATACTCTCACCCAAAAACATGGAGCCTTCCAAAATCTCTGGGCTAATTGTGAACATTTCAACC
::::::::::::.::.::.: :::.:::.:::::::..:.:: ::.::::::::::.::::::::::::: ::::::::::.:::::::::::.::::::
CTTTTTACCAGAAGCGGAAAGGTTTTCTCTGAAAACTGTGCTGTCGCCCAAAAACACGGAGCCTTCCAAATTCTCTGGGCTGATTGTGAACATCTCAACC
--F--L--P--E--A--E--R--F--S--L--K--T--V--L--S--P--K--N--T--E--P--S--K--F--S--G--L--I--V--N--I--S--T-

---------><-----------------------------------------------------------------------------------------
-S--L--I--A--V--L--I--I--T--F--C--I--V--T--V--L--G--R--E--A--L--T--K--G--A--L--W--A--V--F--L--L--A--
AGCCTCATAGCTGTTCTCATCATCACCTTCTGCATTGTGACCGTGCTTGGAAGGGAGGCTCTCACCAAAGGGGCGCTGTGGGCAGTCTTTCTGCTCGCAG
:::::::::                                                                                           
AGCCTCATA-------------------------------------------------------------------------------------------
-S--L--I--------------------------------------------------------------------------------------------

----------------------------------------------------------------------------><----------------------
G--S--A--L--L--C--A--V--V--T--G--V--I--W--R--Q--P--E--S--K--T--K--L--S--F--K--V--P--F--L--P--V--L--P
GGTCTGCCCTCCTCTGTGCCGTGGTCACGGGCGTCATCTGGAGGCAGCCCGAGAGCAAGACCAAGCTCTCATTTAAGGTTCCCTTCCTGCCAGTGCTCCC
                                                                                      ::::: .:.::.::
--------------------------------------------------------------------------------------CTGCCCATACTTCC
---------------------------------------------------------------------------------------L--P--I--L--P

-------------------------------------------------------------------------------------><-------------
--I--L--S--I--F--V--N--V--Y--L--M--M--Q--L--D--Q--G--T--W--V--R--F--A--V--W--M--L--I--G--F--I--I--Y-
CATCCTGAGCATCTTCGTGAACGTCTATCTCATGATGCAGCTGGACCAGGGCACCTGGGTCCGGTTTGCTGTGTGGATGCTGATAGGCTTCATCATCTAC
:.:::::::::::::.::::::::::::::::::::: :::::::::::::::: :::::::::::: : ::::::            ::: ::::::::
CGTCCTGAGCATCTTTGTGAACGTCTATCTCATGATGNAGCTGGACCAGGGCACGTGGGTCCGGTTTNCAGTGTGG------------TTCTTCATCTAC
--V--L--S--I--F--V--N--V--Y--L--M--M--X--L--D--Q--G--T--W--V--R--F--X--V--W--------------F--F--I--Y-

----------------------------------------------------------------------------------------->
-F--G--Y--G--L--W--H--S--E--E--A--S--L--D--A--D--Q--A--R--T--P--D--G--N--L--D--Q--C--K--*-
TTTGGCTATGGCCTGTGGCACAGCGAGGAGGCGTCCCTGGATGCCGACCAAGCAAGGACTCCTGACGGCAACTTGGACCAGTGCAAGTGA
::.:::::.::::: ::::::::::::::::: ::::::: .::::::::::::::::::::::::::.:::.::::::: :::::::::
TTCGGCTACGGCCTCTGGCACAGCGAGGAGGCCTCCCTGGCCGCCGACCAAGCAAGGACTCCTGACGGTAACCTGGACCATTGCAAGTGA
-F--G--Y--G--L--W--H--S--E--E--A--S--L--A--A--D--Q--A--R--T--P--D--G--N--L--D--H--C--K--*-

Pig Consensus Sequence

>BGISUST0000895671
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------CTTTTAACTCTGGGCGTGAAAGAGTCAGCCATGGTCAACAAAATATTCACGTGTATCAACGTTCTGGTC
CTGGGCTTCATAATGGTGTCAGGATTTGTGAAAGGATCCATCAAAAACTGGCAGCTCACGGAGGAGGACTTCCGGAACACCTCCGGTCATCTCTGCCTGA
AC--------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------GTTATCTATGCCATGGCTGA
AGACGGGCTGCTGTTTAAGTTTTTGGCCAAGATCAACGACCGGACCAAAACACCAATAATCGCCACGTTAGCCTCGGGCGCCATT------GTCATGGCC
TTCCTCTTTGACCTGAAGGACTTGGTGGACCTCATGTCCATTGGCACGCTCCTGGCGTACTCGTTGGTGGCCGCCTGTGTGTTGGTCTTA---TACCAGC
CGGAGCAGCCGAACATGGTGTACCAGATGGCCCGAACCAGCGACGAGCTGGACCCCGTGGACCAGAACGAGCTGGTGAGCACCAGCGATTCCCAGACGGG
CTTTTTACCAGAAGCGGAAAGGTTTTCTCTGAAAACTGTGCTGTCGCCCAAAAACACGGAGCCTTCCAAATTCTCTGGGCTGATTGTGAACATCTCAACC
AGCCTCATA-------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------CTGCCCATACTTCC
CGTCCTGAGCATCTTTGTGAACGTCTATCTCATGATGNAGCTGGACCAGGGCACGTGGGTCCGGTTTNCAGTGTGG------------TTCTTCATCTAC
TTCGGCTACGGCCTCTGGCACAGCGAGGAGGCCTCCCTGGCCGCCGACCAAGCAAGGACTCCTGACGGTAACCTGGACCATTGCAAGTGA


>BGISUSP0000895671
----------------------------------------------------------------------------------------------------
-----------------------------------------------------------------------------LLTLGVKESAMVNKIFTCINVLV
LGFIMVSGFVKGSIKNWQLTEEDFRNTSGHLCLN------------------------------------------------------------------
------------------------------------------------------------VIYAMAEDGLLFKFLAKINDRTKTPIIATLASGAI--VMA
FLFDLKDLVDLMSIGTLLAYSLVAACVLVL-YQPEQPNMVYQMARTSDELDPVDQNELVSTSDSQTGFLPEAERFSLKTVLSPKNTEPSKFSGLIVNIST
SLI-----------------------------------------------------------LPILPVLSIFVNVYLMM-LDQGTWVRF-VW----FFIY
FGYGLWHSEEASLAADQARTPDGNLDHCK*