Sequences
EST Library Info
ebs1Foetus 50 days, brain stem
nco2Newborn 115 days, colon
nlu1Newborn 115 days, lung
relu1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000106268 (click for geneview)
Transcript ID ENST00000343985(link to ensembl)
Symbol NUDT1
Localtion Chromosome:7:2055868:2064036:1 band: 7p22.3
Description 7,8-dihydro-8-oxoguanine triphosphatase (EC 3.1.6.-) (8-oxo-dGTPase) (Nucleoside diphosphate-linked moiety X motif 1) (Nudix motif 1). [Source:Uniprot/SWISSPROT;Acc:P36639]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------------------------------><------------------------------------------
-M--S--G--I--S--P--Q--Q--M--G--E--P--E--G--S--W--S--G--K--N--P--G--T-----M--G--A--S--R--L--Y--T--L--
ATGAGTGGAATTAGCCCTCAGCAGATGGGGGAGCCAGAAGGCAGTTGGAGTGGGAAGAACCCAGGGACC---ATGGGCGCCTCCAGGCTCTATACCCTGG
                                                            ::::: :::   ::::::::::: ::::::::.:::.:::
------------------------------------------------------------CCAGGCACCG--ATGGGCGCCTCGAGGCTCTACACCTTGG
-------------------------------------------------------------P--G--T--\--M--G--A--S--R--L--Y--T--L--

----------------------------------------------------------------------------------------------------
V--L--V--L--Q--P--Q--R--V--L--L--G--M--K--K--R--G--F--G--A--G--R--W--N--G--F--G--G--K--V--Q--E--G--E
TGCTGGTCCTGCAGCCTCAGCGAGTTCTCCTGGGCATGAAAAAGCGAGGCTTCGGGGCCGGCCGGTGGAATGGCTTTGGGGGCAAAGTGCAAGAAGGAGA
: ::::: :::::::::::::::::.::::::::::::::.::.:::::::::::::::::::: :::::.:::::.::::::::::: :::::::::::
TCCTGGTGCTGCAGCCTCAGCGAGTCCTCCTGGGCATGAAGAAACGAGGCTTCGGGGCCGGCCGCTGGAACGGCTTCGGGGGCAAAGTTCAAGAAGGAGA
V--L--V--L--Q--P--Q--R--V--L--L--G--M--K--K--R--G--F--G--A--G--R--W--N--G--F--G--G--K--V--Q--E--G--E

-----------------------><---------------------------------------------------------------------------
--T--I--E--D--G--A--R--R--E--L--Q--E--E--S--G--L--T--V--D--A--L--H--K--V--G--Q--I--V--F--E--F--V--G-
GACCATCGAGGATGGGGCTAGGAGGGAGCTGCAGGAGGAGAGCGGTCTGACAGTGGACGCCCTGCACAAGGTGGGCCAGATCGTGTTTGAGTTCGTGGGC
::::::::::::.: :::.:.:   :::::::::::.::::::::.:::::.:::::::. ::.:::::::::::::::::::::::.:::::::..::.
GACCATCGAGGACGCGGCCAAG---GAGCTGCAGGAAGAGAGCGGCCTGACGGTGGACGTGCTACACAAGGTGGGCCAGATCGTGTTCGAGTTCGCAGGT
--T--I--E--D--A--A--K-----E--L--Q--E--E--S--G--L--T--V--D--V--L--H--K--V--G--Q--I--V--F--E--F--A--G-

---------------------------------------------------------------------><-----------------------------
-E--P--E--L--M--D--V--H--V--F--C--T--D--S--I--Q--G--T--P--V--E--S--D--E--M--R--P--C--W--F--Q--L--D--
GAGCCTGAGCTCATGGACGTGCATGTCTTCTGCACAGACAGCATCCAGGGGACCCCCGTGGAGAGCGACGAAATGCGCCCATGCTGGTTCCAGCTGGATC
:: ::.::::: :::::::::::..:::::.:::::::::::.:::::::::: ::.: ::::::::::   :::::::: .. ::::::::::::::.:
GACCCCGAGCTGATGGACGTGCACATCTTCCGCACAGACAGCGTCCAGGGGACGCCTGAGGAGAGCGAC---ATGCGCCCCCAGTGGTTCCAGCTGGACC
-D--P--E--L--M--D--V--H--I--F--R--T--D--S--V--Q--G--T--P--E--E--S--D-----M--R--P--Q--W--F--Q--L--D--

----------------------------------------------------------------------------------------------------
Q--I--P--F--K--D--M--W--P--D--D--S--Y--W--F--P--L--L--L--Q--K--K--K--F--H--G--Y--F--K--F--Q--G--Q--D
AGATCCCCTTCAAGGACATGTGGCCCGACGACAGCTACTGGTTTCCACTCCTGCTTCAGAAGAAGAAATTCCACGGGTACTTCAAGTTCCAGGGTCAGGA
:::::::.:::.. :::::::::::.::.::: :.::::::::.:: ::::::::::::::::::::.::::..:: ::::::::::::::.::.:: ::
AGATCCCTTTCGGTGACATGTGGCCTGATGACCGTTACTGGTTCCCCCTCCTGCTTCAGAAGAAGAAGTTCCGTGGCTACTTCAAGTTCCAAGGCCACGA
Q--I--P--F--G--D--M--W--P--D--D--R--Y--W--F--P--L--L--L--Q--K--K--K--F--R--G--Y--F--K--F--Q--G--H--D

------------------------------------------>
--T--I--L--D--Y--T--L--R--E--V--D--T--V--*-
CACCATCCTGGACTACACACTCCGCGAGGTGGACACGGTCTAG
::::::: :::::.::::.:::::::::::::::.::::::::
CACCATCGTGGACCACACGCTCCGCGAGGTGGACGCGGTCTAG
--T--I--V--D--H--T--L--R--E--V--D--A--V--*-

Pig Consensus Sequence

>BGISUST0000899850
------------------------------------------------------------CCAGGCACcaTGGGCGCCTCGAGGCTCTACACCTTGGTCC
TGGTGCTGCAGCCTCAGCGAGTCCTCCTGGGCATGAAGAAACGAGGCTTCGGGGCCGGCCGCTGGAACGGCTTCGGGGGCAAAGTTCAAGAAGGAGAGAC
CATCGAGGACGCGGCCAAG---GAGCTGCAGGAAGAGAGCGGCCTGACGGTGGACGTGCTACACAAGGTGGGCCAGATCGTGTTCGAGTTCGCAGGTGAC
CCCGAGCTGATGGACGTGCACATCTTCCGCACAGACAGCGTCCAGGGGACGCCTGAGGAGAGCGAC---ATGCGCCCCCAGTGGTTCCAGCTGGACCAGA
TCCCTTTCGGTGACATGTGGCCTGATGACCGTTACTGGTTCCCCCTCCTGCTTCAGAAGAAGAAGTTCCGTGGCTACTTCAAGTTCCAAGGCCACGACAC
CATCGTGGACCACACGCTCCGCGAGGTGGACGCGGTCTAG


>BGISUSP0000899850
--------------------PGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDAAK-ELQEESGLTVDVLHKVGQIVFEFAGD
PELMDVHIFRTDSVQGTPEESD-MRPQWFQLDQIPFGDMWPDDRYWFPLLLQKKKFRGYFKFQGHDTIVDHTLREVDAV*