Sequences
EST Library Info
nmm1Newborn 115 days, mucosal membranes
pldo2Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000127334 (click for geneview)
Transcript ID ENST00000344096(link to ensembl)
Symbol DYRK2
Localtion Chromosome:12:66329021:66340410:1 band: 12q15
Description Dual-specificity tyrosine-phosphorylation regulated kinase 2 (EC 2.7.1.112) (EC 2.7.1.37). [Source:Uniprot/SWISSPROT;Acc:Q92630]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----------------------------------------------><--------------------------------------------------
-M--L--T--R--K--P--S--A--A--A--P--A--A--Y--P--T--G--R--G--G--D--S--A--V--R--Q--L--Q--A--S--P--G--L--
ATGTTAACCAGGAAACCTTCGGCCGCCGCTCCCGCCGCCTACCCGACCGGCCGAGGTGGGGACAGCGCCGTTCGTCAGCTTCAGGCTTCCCCGGGGCTCG
::::::::::::::::::::::::::::::::::::::::::::::::   ::::: :::::::::::::::::::::::::::::::::::::::::::
ATGTTAACCAGGAAACCTTCGGCCGCCGCTCCCGCCGCCTACCCGACC---CGAGGAGGGGACAGCGCCGTTCGTCAGCTTCAGGCTTCCCCGGGGCTCG
-M--L--T--R--K--P--S--A--A--A--P--A--A--Y--P--T-----R--G--G--D--S--A--V--R--Q--L--Q--A--S--P--G--L--

-------------------------------------------------------------------------------------------------><-
G--A--G--A--T--R--S--G--V--G--T--G--P--P--S--P--I--A--L--P--P--L--R--A--S--N--A--A--A--A--A--H--T--I
GTGCAGGGGCCACCCGGAGCGGAGTGGGGACTGGCCCGCCCTCCCCCATCGCCCTGCCGCCTCTCCGGGCCAGCAACGCTGCCGCCGCAGCCCACACGAT
::::::::::: :::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::  
GTGCAGGGGCCCCCCGGAGCGGAGTGGGGACCGGCCCGCCCTCCCCCATCGCCCTGCCGCCTCTCCGGGCCAGCAACGCTGCCGCCGCAGCCCACACG--
G--A--G--A--P--R--S--G--V--G--T--G--P--P--S--P--I--A--L--P--P--L--R--A--S--N--A--A--A--A--A--H--T---

----------------------------------------------------------------------------------------------------
--G--G--S--K--H--T--M--N--D--H--L--H--V--G--S--H--A--H--G--Q--I--Q--V--Q--Q--L--F--E--D--N--S--N--K-
TGGCGGCAGTAAGCACACAATGAATGATCACCTGCATGTCGGCAGCCACGCTCACGGACAGATCCAGGTTCAACAGTTGTTTGAGGATAACAGTAACAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-R--T--V--L--T--T--Q--P--N--G--L--T--T--V--G--K--T--G--L--P--V--V--P--E--R--Q--L--D--S--I--H--R--R--
CGGACAGTGCTCACGACACAACCAAATGGGCTTACAACAGTGGGCAAAACGGGCTTGCCAGTGGTGCCAGAGCGGCAGCTGGACAGCATTCATAGACGGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
Q--G--S--S--T--S--L--K--S--M--E--G--M--G--K--V--K--A--T--P--M--T--P--E--Q--A--M--K--Q--Y--M--Q--K--L
AGGGGAGCTCCACCTCTCTAAAGTCCATGGAAGGCATGGGGAAGGTGAAAGCCACCCCCATGACACCTGAACAAGCAATGAAGCAATACATGCAAAAACT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--T--A--F--E--H--H--E--I--F--S--Y--P--E--I--Y--F--L--G--L--N--A--K--K--R--Q--G--M--T--G--G--P--N--N-
CACAGCCTTCGAACACCATGAGATTTTCAGCTACCCTGAAATATATTTCTTGGGTCTAAATGCTAAGAAGCGCCAGGGCATGACAGGTGGGCCCAACAAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--G--Y--D--D--D--Q--G--S--Y--V--Q--V--P--H--D--H--V--A--Y--R--Y--E--V--L--K--V--I--G--K--G--S--F--
GGTGGCTATGATGATGACCAGGGATCATATGTGCAGGTGCCCCACGATCACGTGGCTTACAGGTATGAGGTCCTCAAGGTCATTGGGAAGGGGAGCTTTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
G--Q--V--V--K--A--Y--D--H--K--V--H--Q--H--V--A--L--K--M--V--R--N--E--K--R--F--H--R--Q--A--A--E--E--I
GGCAGGTGGTCAAGGCCTACGATCACAAAGTCCACCAGCACGTGGCCCTAAAGATGGTGCGGAATGAGAAGCGCTTCCACCGGCAAGCAGCGGAGGAGAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--R--I--L--E--H--L--R--K--Q--D--K--D--N--T--M--N--V--I--H--M--L--E--N--F--T--F--R--N--H--I--C--M--T-
CCGAATCCTGGAACACCTGCGGAAGCAGGACAAGGATAACACAATGAATGTCATCCATATGCTGGAGAATTTCACCTTCCGCAACCACATCTGCATGACG
                                                 ::::::::.:::::::::::.::::::::::::::::::::::::::::::
-------------------------------------------------GTCATCCACATGCTGGAGAACTTCACCTTCCGCAACCACATCTGCATGACG
--------------------------------------------------V--I--H--M--L--E--N--F--T--F--R--N--H--I--C--M--T-

----------------------------------------------------------------------------------------------------
-F--E--L--L--S--M--N--L--Y--E--L--I--K--K--N--K--F--Q--G--F--S--L--P--L--V--R--K--F--A--H--S--I--L--
TTTGAGCTGCTGAGCATGAACCTCTATGAGCTCATCAAGAAGAATAAATTCCAGGGCTTCAGTCTGCCTTTGGTTCGCAAGTTTGCCCACTCGATTCTGC
::.::::::::::::::::: :::::.:::::::::::::::::.::.::::::::::::::.::::::::::::::::::::::::::::: ::.::::
TTCGAGCTGCTGAGCATGAA-CTCTACGAGCTCATCAAGAAGAACAAGTTCCAGGGCTTCAGCCTGCCTTTGGTTCGCAAGTTTGCCCACTCCATCCTGC
-F--E--L--L--S--M--N--L--Y--E--L--I--K--K--N--K--F--Q--G--F--S--L--P--L--V--R--K--F--A--H--S--I--L--

----------------------------------------------------------------------------------------------------
Q--C--L--D--A--L--H--K--N--R--I--I--H--C--D--L--K--P--E--N--I--L--L--K--Q--Q--G--R--S--G--I--K--V--I
AGTGCTTGGATGCTTTGCACAAAAACAGAATAATTCACTGTGACCTTAAGCCCGAGAACATTTTGTTAAAGCAGCAGGGTAGAAGCGGTATTAAAGTAAT
:::::.::::.:::.:::::::::::::.:: :::::::::::::: :::::.:::::::::::.::.:::::::::::::::::.:: ::::::::.::
AGTGCCTGGACGCTCTGCACAAAAACAGGATCATTCACTGTGACCTGAAGCCTGAGAACATTTTATTGAAGCAGCAGGGTAGAAGTGGGATTAAAGTGAT
Q--C--L--D--A--L--H--K--N--R--I--I--H--C--D--L--K--P--E--N--I--L--L--K--Q--Q--G--R--S--G--I--K--V--I

----------------------------------------------------------------------------------------------------
--D--F--G--S--S--C--Y--E--H--Q--R--V--Y--T--Y--I--Q--S--R--F--Y--R--A--P--E--V--I--L--G--A--R--Y--G-
TGATTTTGGCTCCAGTTGTTACGAGCATCAGCGTGTCTACACGTACATCCAGTCGCGTTTTTACCGGGCTCCAGAAGTGATCCTTGGGGCCAGGTATGGC
::::::.:::::::::::::::::::::::::: :::::::::::::::::::: ::::::::::::::.::.::::::::::: :: ::::::::.:::
TGATTTCGGCTCCAGTTGTTACGAGCATCAGCGGGTCTACACGTACATCCAGTCCCGTTTTTACCGGGCCCCGGAAGTGATCCTGGGCGCCAGGTACGGC
--D--F--G--S--S--C--Y--E--H--Q--R--V--Y--T--Y--I--Q--S--R--F--Y--R--A--P--E--V--I--L--G--A--R--Y--G-

----------------------------------------------------------------------------------------------------
-M--P--I--D--M--W--S--L--G--C--I--L--A--E--L--L--T--G--Y--P--L--L--P--G--E--D--E--G--D--Q--L--A--C--
ATGCCCATTGATATGTGGAGCCTGGGCTGCATTTTAGCAGAGCTCCTGACGGGTTACCCCCTCTTGCCTGGGGAAGATGAAGGGGACCAGCTGGCCTGTA
:::::::::::.::::::::::::::::::::..: ::.:::::::: :: :::::::::::::::::::::::.::.::::::::::::::::::::::
ATGCCCATTGACATGTGGAGCCTGGGCTGCATCCTCGCGGAGCTCCTCACTGGTTACCCCCTCTTGCCTGGGGAGGACGAAGGGGACCAGCTGGCCTGTA
-M--P--I--D--M--W--S--L--G--C--I--L--A--E--L--L--T--G--Y--P--L--L--P--G--E--D--E--G--D--Q--L--A--C--

----------------------------------------------------------------------------------------------------
M--I--E--L--L--G--M--P--S--Q--K--L--L--D--A--S--K--R--A--K--N--F--V--S--S--K--G--Y--P--R--Y--C--T--V
TGATTGAACTGTTGGGCATGCCCTCACAGAAACTGCTGGATGCATCCAAACGAGCCAAAAATTTTGTGAGCTCCAAGGGTTATCCCCGTTACTGCACTGT
:::::::::::.::::::::::::: ::::::::::::::::: ::::::::::::::::::::::::::::::::::::::::::::::::::::::::
TGATTGAACTGCTGGGCATGCCCTCCCAGAAACTGCTGGATGCCTCCAAACGAGCCAAAAATTTTGTGAGCTCCAAGGGTTATCCCCGTTACTGCACTGT
M--I--E--L--L--G--M--P--S--Q--K--L--L--D--A--S--K--R--A--K--N--F--V--S--S--K--G--Y--P--R--Y--C--T--V

----------------------------------------------------------------------------------------------------
--T--T--L--S--D--G--S--V--V--L--N--G--G--R--S--R--R--G--K--L--R--G--P--P--E--S--R--E--W--G--N--A--L-
CACGACTCTCTCAGATGGCTCTGTGGTCCTAAACGGAGGCCGTTCCCGGAGGGGGAAACTGAGGGGCCCACCGGAGAGCAGAGAGTGGGGGAACGCGCTG
::::::::::::.::.:::::.:::::.:: :::::::::::::::::::::::::::::: :::::::::::::::::::::::::::::::.::.:::
CACGACTCTCTCGGACGGCTCCGTGGTTCTCAACGGAGGCCGTTCCCGGAGGGGGAAACTGCGGGGCCCACCGGAGAGCAGAGAGTGGGGGAATGCACTG
--T--T--L--S--D--G--S--V--V--L--N--G--G--R--S--R--R--G--K--L--R--G--P--P--E--S--R--E--W--G--N--A--L-

----------------------------------------------------------------------------------------------------
-K--G--C--D--D--P--L--F--L--D--F--L--K--Q--C--L--E--W--D--P--A--V--R--M--T--P--G--Q--A--L--R--H--P--
AAGGGGTGTGATGATCCCCTTTTCCTTGACTTCTTAAAACAGTGTTTAGAGTGGGATCCTGCAGTGCGCATGACCCCAGGCCAGGCTTTGCGGCACCCCT
:::::::::::.::.:::::::::::::::::::::::::::::::::::::::::::::::.:: ::::::::::: ::::::::::::::::::::.:
AAGGGGTGTGACGACCCCCTTTTCCTTGACTTCTTAAAACAGTGTTTAGAGTGGGATCCTGCGGTTCGCATGACCCCTGGCCAGGCTTTGCGGCACCCTT
-K--G--C--D--D--P--L--F--L--D--F--L--K--Q--C--L--E--W--D--P--A--V--R--M--T--P--G--Q--A--L--R--H--P--

----------------------------------------------------------------------------------------------------
W--L--R--R--R--L--P--K--P--P--T--G--E--K--T--S--V--K--R--I--T--E--S--T--G--A--I--T--S--I--S--K--L--P
GGCTGAGGAGGCGGTTGCCAAAGCCTCCCACCGGGGAGAAAACGTCAGTGAAAAGGATAACTGAGAGCACCGGTGCTATCACATCTATATCCAAGTTACC
::::::::::::::.::::::::::::: :: ::::::::.::::::::::::::::: ::.::::::::.::::::::::::::.:: :::::::::::
GGCTGAGGAGGCGGCTGCCAAAGCCTCCGACGGGGGAGAAGACGTCAGTGAAAAGGATCACCGAGAGCACTGGTGCTATCACATCCATTTCCAAGTTACC
W--L--R--R--R--L--P--K--P--P--T--G--E--K--T--S--V--K--R--I--T--E--S--T--G--A--I--T--S--I--S--K--L--P

----------------------------------------------------------------------------------------------------
--P--P--S--S--S--A--S--K--L--R--T--N--L--A--Q--M--T--D--A--N--G--N--I--Q--Q--R--T--V--L--P--K--L--V-
TCCACCTTCTAGCTCAGCTTCCAAACTGAGGACTAATTTGGCGCAGATGACAGATGCCAATGGGAATATTCAGCAGAGGACAGTGTTGCCAAAACTTGTT
:::::::::.::::::::::::::::::::::::::::::::.:::::::::::::::::.:::::::::::::::::::::::::::::::::::::::
TCCACCTTCCAGCTCAGCTTCCAAACTGAGGACTAATTTGGCACAGATGACAGATGCCAACGGGAATATTCAGCAGAGGACAGTGTTGCCAAAACTTGTT
--P--P--S--S--S--A--S--K--L--R--T--N--L--A--Q--M--T--D--A--N--G--N--I--Q--Q--R--T--V--L--P--K--L--V-

------
-S--*-
AGCTGA
::::::
AGCTGA
-S--*-

Pig Consensus Sequence

>BGISUST0000893998
ATGTTAACCAGGAAACCTTCGGCCGCCGCTCCCGCCGCCTACCCGACC---CGAGGAGGGGACAGCGCCGTTCGTCAGCTTCAGGCTTCCCCGGGGCTCG
GTGCAGGGGCCCCCCGGAGCGGAGTGGGGACCGGCCCGCCCTCCCCCATCGCCCTGCCGCCTCTCCGGGCCAGCAACGCTGCCGCCGCAGCCCACACG--
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------GTCATCCACATGCTGGAGAACTTCACCTTCCGCAACCACATCTGCATGACG
TTCGAGCTGCTGAGCATgcTCTACGAGCTCATCAAGAAGAACAAGTTCCAGGGCTTCAGCCTGCCTTTGGTTCGCAAGTTTGCCCACTCCATCCTGCAGT
GCCTGGACGCTCTGCACAAAAACAGGATCATTCACTGTGACCTGAAGCCTGAGAACATTTTATTGAAGCAGCAGGGTAGAAGTGGGATTAAAGTGATTGA
TTTCGGCTCCAGTTGTTACGAGCATCAGCGGGTCTACACGTACATCCAGTCCCGTTTTTACCGGGCCCCGGAAGTGATCCTGGGCGCCAGGTACGGCATG
CCCATTGACATGTGGAGCCTGGGCTGCATCCTCGCGGAGCTCCTCACTGGTTACCCCCTCTTGCCTGGGGAGGACGAAGGGGACCAGCTGGCCTGTATGA
TTGAACTGCTGGGCATGCCCTCCCAGAAACTGCTGGATGCCTCCAAACGAGCCAAAAATTTTGTGAGCTCCAAGGGTTATCCCCGTTACTGCACTGTCAC
GACTCTCTCGGACGGCTCCGTGGTTCTCAACGGAGGCCGTTCCCGGAGGGGGAAACTGCGGGGCCCACCGGAGAGCAGAGAGTGGGGGAATGCACTGAAG
GGGTGTGACGACCCCCTTTTCCTTGACTTCTTAAAACAGTGTTTAGAGTGGGATCCTGCGGTTCGCATGACCCCTGGCCAGGCTTTGCGGCACCCTTGGC
TGAGGAGGCGGCTGCCAAAGCCTCCGACGGGGGAGAAGACGTCAGTGAAAAGGATCACCGAGAGCACTGGTGCTATCACATCCATTTCCAAGTTACCTCC
ACCTTCCAGCTCAGCTTCCAAACTGAGGACTAATTTGGCACAGATGACAGATGCCAACGGGAATATTCAGCAGAGGACAGTGTTGCCAAAACTTGTTAGC
TGA


>BGISUSP0000893998
MLTRKPSAAAPAAYPT-RGGDSAVRQLQASPGLGAGAPRSGVGTGPPSPIALPPLRASNAAAAAHT----------------------------------
----------------------------------------------------------------------------------------------------
-----------------------------------------------------------------------------------VIHMLENFTFRNHICMT
FELLSMLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGM
PIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPESREWGNALK
GCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLVS
*