Sequences
EST Library Info
cov1Ovary - RNA from China
ecc1Foetus 50 days, cortex cerebri
jca1Joint capsule
mcp1Mammae, collostrum producing
nmm1Newborn 115 days, mucosal membranes
plac1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000144647 (click for geneview)
Transcript ID ENST00000344697(link to ensembl)
Symbol NP_116195.2
Localtion Chromosome:3:43095735:43122569:-1 band: 3p22.1
Description hypothetical protein FLJ14566
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--H--L--S--A--V--F--N--A--L--L--V--S--V--L--A--A--V--L--W--K--H--V--R--L--R--E--H--A--A--T--L--E--
ATGCACCTCTCGGCGGTGTTCAACGCCCTCCTGGTGTCGGTGCTGGCAGCGGTCCTGTGGAAGCATGTGCGGCTGCGTGAGCATGCAGCCACACTGGAGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
E--E--L--A--L--S--R--Q--A--T--E--P--A--P--A--L--R--I--D--Y--P--K--A--L--Q--I--L--M--E--G--G--T--H--M
AGGAGCTGGCCCTCAGCCGACAGGCCACAGAGCCAGCCCCAGCACTGAGGATCGACTACCCGAAGGCACTGCAGATCCTGATGGAGGGCGGCACACACAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--V--C--T--G--R--T--H--T--D--R--I--C--R--F--K--W--L--C--Y--S--N--E--A--E--E--F--I--F--F--H--G--N--T-
GGTGTGCACGGGCCGCACGCACACAGACCGCATCTGCCGCTTCAAGTGGCTCTGCTACTCCAACGAGGCTGAGGAGTTCATCTTCTTCCATGGCAACACC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-S--V--M--L--P--N--L--G--S--R--R--F--Q--P--A--L--L--D--L--S--T--V--E--D--H--N--T--Q--Y--F--N--F--V--
TCTGTCATGCTGCCCAACCTGGGCTCCCGGCGCTTCCAGCCAGCCCTGCTCGACCTATCCACCGTGGAGGACCACAACACTCAGTACTTCAACTTCGTGG
                                                                     :::::::::::.:::::::::::::::::::
---------------------------------------------------------------------GACCACAACACCCAGTACTTCAACTTCGTGG
----------------------------------------------------------------------D--H--N--T--Q--Y--F--N--F--V--

----------------------------------------------------------------------------------------------------
E--L--P--A--A--A--L--R--F--M--P--K--P--V--F--V--P--D--V--A--L--I--A--N--R--F--N--P--D--N--L--M--H--V
AGCTGCCTGCTGCTGCCCTGCGCTTCATGCCCAAGCCGGTGTTCGTGCCAGACGTGGCCCTCATCGCCAACCGCTTCAACCCCGACAACCTCATGCACGT
::::::: ::.::.:::::::::::::::::::::::.::::::::::: ::::::::::: :: :::::::::::::::::::::::.:::::::::::
AGCTGCCGGCCGCCGCCCTGCGCTTCATGCCCAAGCCAGTGTTCGTGCCCGACGTGGCCCTGATGGCCAACCGCTTCAACCCCGACAATCTCATGCACGT
E--L--P--A--A--A--L--R--F--M--P--K--P--V--F--V--P--D--V--A--L--M--A--N--R--F--N--P--D--N--L--M--H--V

----------------------------------------------------------------------------------------------------
--F--H--D--D--L--L--P--L--F--Y--T--L--R--Q--F--P--G--L--A--H--E--A--R--L--F--F--M--E--G--W--G--E--G-
CTTTCATGACGACCTGCTGCCACTCTTCTACACCCTGCGGCAGTTTCCCGGCCTGGCCCACGAGGCACGGCTCTTCTTCATGGAGGGCTGGGGCGAGGGT
:::.::.:::::::::::::: ::::::::::: ::::: :::::.::::: :::::::..::::: ::::::::.:::::::::::::::::.:::::.
CTTCCACGACGACCTGCTGCCCCTCTTCTACACGCTGCGCCAGTTCCCCGGGCTGGCCCGTGAGGCCCGGCTCTTTTTCATGGAGGGCTGGGGTGAGGGC
--F--H--D--D--L--L--P--L--F--Y--T--L--R--Q--F--P--G--L--A--R--E--A--R--L--F--F--M--E--G--W--G--E--G-

----------------------------------------------------------------------------------------------------
-A--H--F--D--L--Y--K--L--L--S--P--K--Q--P--L--L--R--A--Q--L--K--T--L--G--R--L--L--C--F--S--H--A--F--
GCACACTTCGACCTCTACAAGCTGCTCAGCCCCAAGCAGCCTCTCCTGCGGGCACAGCTGAAGACCCTGGGCCGGCTGCTGTGCTTCTCCCATGCTTTTG
:: :::::.::::::::.:::::::::::::::::::::::.:::::::::::::::::::::.::::::::::.:::::::::::.:::::.::.::::
GCCCACTTTGACCTCTATAAGCTGCTCAGCCCCAAGCAGCCCCTCCTGCGGGCACAGCTGAAGGCCCTGGGCCGACTGCTGTGCTTTTCCCACGCCTTTG
-A--H--F--D--L--Y--K--L--L--S--P--K--Q--P--L--L--R--A--Q--L--K--A--L--G--R--L--L--C--F--S--H--A--F--

----------------------------------------------------------------------------------------------------
V--G--L--S--K--I--T--T--W--Y--Q--Y--G--F--V--Q--P--Q--G--P--K--A--N--I--L--V--S--G--N--E--I--R--Q--F
TGGGCCTCTCCAAGATCACTACCTGGTACCAGTATGGCTTTGTGCAGCCCCAGGGCCCGAAGGCCAACATCCTCGTCTCAGGCAATGAGATCCGGCAGTT
::::::::::::::.::::.::::::::::::::.:::::::: :::::::::::::::::::::::::::::.:::::::::::.:::::::::::.::
TGGGCCTCTCCAAGGTCACCACCTGGTACCAGTACGGCTTTGTCCAGCCCCAGGGCCCGAAGGCCAACATCCTTGTCTCAGGCAACGAGATCCGGCAATT
V--G--L--S--K--V--T--T--W--Y--Q--Y--G--F--V--Q--P--Q--G--P--K--A--N--I--L--V--S--G--N--E--I--R--Q--F

----------------------------------------------------------------------------------------------------
--A--R--F--M--T--E--K--L--N--V--S--H--T--G--V--P--L--G--E--E--Y--I--L--V--F--S--R--T--Q--N--R--L--I-
TGCACGGTTCATGACAGAAAAGCTGAACGTGAGCCACACAGGAGTCCCCCTAGGCGAGGAGTACATTCTGGTCTTTAGCCGAACCCAGAACAGACTCATT
:::::::::: ::::.:::::::::::.:::::::::.::::.: : ::::.::::::::::::::.::::::::.::::: :::::::::::::::::.
TGCACGGTTCCTGACGGAAAAGCTGAATGTGAGCCACGCAGGGGGCGCCCTGGGCGAGGAGTACATCCTGGTCTTCAGCCGCACCCAGAACAGACTCATC
--A--R--F--L--T--E--K--L--N--V--S--H--A--G--G--A--L--G--E--E--Y--I--L--V--F--S--R--T--Q--N--R--L--I-

----------------------------------------------------------------------------------------------------
-L--N--E--A--E--L--L--L--A--L--A--Q--E--F--Q--M--K--T--V--T--V--S--L--E--D--H--T--F--A--D--V--V--R--
CTGAATGAGGCAGAGCTGCTGCTGGCACTGGCCCAGGAGTTCCAGATGAAGACAGTGACAGTGTCCCTGGAGGACCACACCTTTGCTGATGTCGTGCGGC
:::::::::::::::::::::::::: ::::: ::::::::::::::::::::.:::::::::::::::::::::::..::::::: ::::::::: :.:
CTGAATGAGGCAGAGCTGCTGCTGGCCCTGGCGCAGGAGTTCCAGATGAAGACGGTGACAGTGTCCCTGGAGGACCATGCCTTTGCAGATGTCGTGAGAC
-L--N--E--A--E--L--L--L--A--L--A--Q--E--F--Q--M--K--T--V--T--V--S--L--E--D--H--A--F--A--D--V--V--R--

----------------------------------------------------------------------------------------------------
L--V--S--N--A--S--M--L--V--S--M--H--G--A--Q--L--V--T--T--L--F--L--P--R--G--A--T--V--V--E--L--F--P--Y
TGGTCAGCAATGCCTCCATGCTGGTCAGCATGCATGGGGCCCAGCTGGTCACCACCCTCTTCCTGCCCCGTGGGGCAACTGTGGTAGAGCTCTTCCCATA
::::::::::.:::::::::::::::::::::::.:::::::::::::::::..::::.::.:::::::: ::::: .:.:::::.::.::.::.:: ::
TGGTCAGCAACGCCTCCATGCTGGTCAGCATGCACGGGGCCCAGCTGGTCACTGCCCTTTTTCTGCCCCGAGGGGCCGCCGTGGTGGAACTTTTTCCTTA
L--V--S--N--A--S--M--L--V--S--M--H--G--A--Q--L--V--T--A--L--F--L--P--R--G--A--A--V--V--E--L--F--P--Y

----------------------------------------------------------------------------------------------------
--A--V--N--P--D--H--Y--T--P--Y--K--T--L--A--M--L--P--G--M--D--L--Q--Y--V--A--W--R--N--M--M--P--E--N-
TGCTGTCAATCCCGACCACTACACTCCCTATAAGACGCTGGCCATGCTGCCTGGCATGGACCTCCAGTATGTAGCCTGGCGGAACATGATGCCAGAGAAC
.::.:::::.::.:::::::::::.:::::::::::::::::.:.::::::::::::::::::::::::..:::::::::::::::.:::::: ::::::
CGCCGTCAACCCTGACCACTACACCCCCTATAAGACGCTGGCTACGCTGCCTGGCATGGACCTCCAGTACATAGCCTGGCGGAACACGATGCCCGAGAAC
--A--V--N--P--D--H--Y--T--P--Y--K--T--L--A--T--L--P--G--M--D--L--Q--Y--I--A--W--R--N--T--M--P--E--N-

----------------------------------------------------------------------------------------------------
-T--V--T--H--P--E--R--P--W--D--Q--G--G--I--T--H--L--D--R--A--E--Q--A--R--I--L--Q--S--R--E--V--P--R--
ACAGTCACACACCCTGAGCGGCCCTGGGATCAGGGGGGCATCACCCATCTGGACCGGGCTGAGCAAGCCCGTATCCTGCAAAGCCGTGAGGTCCCACGGC
::::::::.::::: ::.:::::::::::.::::::::::::.::::.::.::::: :: :::::.::.::.:::::::::::::. ::::::::.::::
ACAGTCACGCACCCGGAACGGCCCTGGGACCAGGGGGGCATCGCCCACCTAGACCGTGCAGAGCAGGCTCGCATCCTGCAAAGCCAGGAGGTCCCGCGGC
-T--V--T--H--P--E--R--P--W--D--Q--G--G--I--A--H--L--D--R--A--E--Q--A--R--I--L--Q--S--Q--E--V--P--R--

----------------------------------------------------------------------------------------------------
H--L--C--C--R--N--P--E--W--L--F--R--I--Y--Q--D--T--K--V--D--I--P--S--L--I--Q--T--I--R--R--V--V--K--G
ATCTCTGTTGCCGGAACCCCGAGTGGCTCTTCCGAATCTACCAGGACACCAAGGTGGACATCCCGTCCCTCATTCAAACCATACGGCGCGTGGTGAAGGG
:.::.::.::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::.:::::::::::::::::.::::::::
ACCTTTGCTGCCGGAACCCCGAGTGGCTCTTCCGAATCTACCAGGACACCAAAGTGGACATCCCGTCCCTCATCCAAACCATACGGCGCGTAGTGAAGGG
H--L--C--C--R--N--P--E--W--L--F--R--I--Y--Q--D--T--K--V--D--I--P--S--L--I--Q--T--I--R--R--V--V--K--G

----------------------------------------------------------------------------------------------------
--R--P--G--P--R--K--Q--K--W--T--V--G--L--Y--P--G--K--V--R--E--A--R--C--Q--A--S--V--H--G--A--S--E--A-
CCGGCCAGGACCACGGAAGCAGAAGTGGACAGTCGGCCTATATCCAGGCAAGGTGCGGGAGGCACGGTGCCAGGCGTCAGTGCATGGCGCCTCCGAGGCC
::::::.::.::.:::::::::::::::::.:::.::::.::.:: :::::::::::::::::.::::::::: ::::.::::: :::::::::::::::
CCGGCCGGGGCCGCGGAAGCAGAAGTGGACGGTCAGCCTGTACCCCGGCAAGGTGCGGGAGGCGCGGTGCCAGTCGTCGGTGCAGGGCGCCTCCGAGGCC
--R--P--G--P--R--K--Q--K--W--T--V--S--L--Y--P--G--K--V--R--E--A--R--C--Q--S--S--V--Q--G--A--S--E--A-

----------------------------------------------------------------------------------------------------
-R--L--T--V--S--W--Q--I--P--W--N--L--K--Y--L--K--V--R--E--V--K--Y--E--V--W--L--Q--E--Q--G--E--N--T--
CGCCTCACTGTCTCCTGGCAGATCCCATGGAACCTTAAATACCTGAAGGTGAGGGAGGTGAAGTACGAGGTGTGGCTGCAGGAGCAGGGGGAGAACACCT
::::::::.:::::::::::::::::.::::::::.::.::::::::::::::::::::::::::.::.:::::::: :::::::::::.::::::::::
CGCCTCACCGTCTCCTGGCAGATCCCGTGGAACCTCAAGTACCTGAAGGTGAGGGAGGTGAAGTATGAAGTGTGGCTCCAGGAGCAGGGAGAGAACACCT
-R--L--T--V--S--W--Q--I--P--W--N--L--K--Y--L--K--V--R--E--V--K--Y--E--V--W--L--Q--E--Q--G--E--N--T--

----------------------------------------------------------------------------------------------------
Y--V--P--Y--I--L--A--L--Q--N--H--T--F--T--E--N--I--K--P--F--T--T--Y--L--V--W--V--R--C--I--F--N--K--I
ACGTGCCTTACATCCTGGCTCTGCAGAACCACACCTTCACTGAGAACATCAAGCCCTTCACCACCTACCTGGTGTGGGTCCGCTGCATCTTCAACAAGAT
:::::::::::::::::.:.::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::.::::::::::::::.:.
ACGTGCCTTACATCCTGACCCTGCAGAACCACACCTTCACTGAGAACATCAAGCCCTTCACCACTTACCTGGTGTGGGTCCGTTGCATCTTCAACAAAAC
Y--V--P--Y--I--L--T--L--Q--N--H--T--F--T--E--N--I--K--P--F--T--T--Y--L--V--W--V--R--C--I--F--N--K--T

------------------------------------------>
--L--L--G--P--F--A--D--V--L--V--C--N--T--*-
CCTCCTGGGACCCTTTGCAGATGTGCTGGTGTGCAACACGTAG
:::::::::::::::::::::.::::: ::::::::::::   
CCTCCTGGGACCCTTTGCAGACGTGCTTGTGTGCAACACG---
--L--L--G--P--F--A--D--V--L--V--C--N--T----

Pig Consensus Sequence

>BGISUST0000892445
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------------------GACCACAACACCCAGTACTTCAACTTCGTGG
AGCTGCCGGCCGCCGCCCTGCGCTTCATGCCCAAGCCAGTGTTCGTGCCCGACGTGGCCCTGATGGCCAACCGCTTCAACCCCGACAATCTCATGCACGT
CTTCCACGACGACCTGCTGCCCCTCTTCTACACGCTGCGCCAGTTCCCCGGGCTGGCCCGTGAGGCCCGGCTCTTTTTCATGGAGGGCTGGGGTGAGGGC
GCCCACTTTGACCTCTATAAGCTGCTCAGCCCCAAGCAGCCCCTCCTGCGGGCACAGCTGAAGGCCCTGGGCCGACTGCTGTGCTTTTCCCACGCCTTTG
TGGGCCTCTCCAAGGTCACCACCTGGTACCAGTACGGCTTTGTCCAGCCCCAGGGCCCGAAGGCCAACATCCTTGTCTCAGGCAACGAGATCCGGCAATT
TGCACGGTTCCTGACGGAAAAGCTGAATGTGAGCCACGCAGGGGGCGCCCTGGGCGAGGAGTACATCCTGGTCTTCAGCCGCACCCAGAACAGACTCATC
CTGAATGAGGCAGAGCTGCTGCTGGCCCTGGCGCAGGAGTTCCAGATGAAGACGGTGACAGTGTCCCTGGAGGACCATGCCTTTGCAGATGTCGTGAGAC
TGGTCAGCAACGCCTCCATGCTGGTCAGCATGCACGGGGCCCAGCTGGTCACTGCCCTTTTTCTGCCCCGAGGGGCCGCCGTGGTGGAACTTTTTCCTTA
CGCCGTCAACCCTGACCACTACACCCCCTATAAGACGCTGGCTACGCTGCCTGGCATGGACCTCCAGTACATAGCCTGGCGGAACACGATGCCCGAGAAC
ACAGTCACGCACCCGGAACGGCCCTGGGACCAGGGGGGCATCGCCCACCTAGACCGTGCAGAGCAGGCTCGCATCCTGCAAAGCCAGGAGGTCCCGCGGC
ACCTTTGCTGCCGGAACCCCGAGTGGCTCTTCCGAATCTACCAGGACACCAAAGTGGACATCCCGTCCCTCATCCAAACCATACGGCGCGTAGTGAAGGG
CCGGCCGGGGCCGCGGAAGCAGAAGTGGACGGTCAGCCTGTACCCCGGCAAGGTGCGGGAGGCGCGGTGCCAGTCGTCGGTGCAGGGCGCCTCCGAGGCC
CGCCTCACCGTCTCCTGGCAGATCCCGTGGAACCTCAAGTACCTGAAGGTGAGGGAGGTGAAGTATGAAGTGTGGCTCCAGGAGCAGGGAGAGAACACCT
ACGTGCCTTACATCCTGACCCTGCAGAACCACACCTTCACTGAGAACATCAAGCCCTTCACCACTTACCTGGTGTGGGTCCGTTGCATCTTCAACAAAAC
CCTCCTGGGACCCTTTGCAGACGTGCTTGTGTGCAACACG


>BGISUSP0000892445
----------------------------------------------------------------------------------------------------
-----------------------DHNTQYFNFVELPAAALRFMPKPVFVPDVALMANRFNPDNLMHVFHDDLLPLFYTLRQFPGLAREARLFFMEGWGEG
AHFDLYKLLSPKQPLLRAQLKALGRLLCFSHAFVGLSKVTTWYQYGFVQPQGPKANILVSGNEIRQFARFLTEKLNVSHAGGALGEEYILVFSRTQNRLI
LNEAELLLALAQEFQMKTVTVSLEDHAFADVVRLVSNASMLVSMHGAQLVTALFLPRGAAVVELFPYAVNPDHYTPYKTLATLPGMDLQYIAWRNTMPEN
TVTHPERPWDQGGIAHLDRAEQARILQSQEVPRHLCCRNPEWLFRIYQDTKVDIPSLIQTIRRVVKGRPGPRKQKWTVSLYPGKVREARCQSSVQGASEA
RLTVSWQIPWNLKYLKVREVKYEVWLQEQGENTYVPYILTLQNHTFTENIKPFTTYLVWVRCIFNKTLLGPFADVLVCNT