Sequences
EST Library Info
nbm1Newborn 115 days, bone marrow (pelvis)
Clusters
Oligos
SNPs

Gene ID ENSG00000172331 (click for geneview)
Transcript ID ENST00000344924(link to ensembl)
Symbol BPGM
Localtion Chromosome:7:133788810:133821820:1 band: 7q33
Description Bisphosphoglycerate mutase (EC 5.4.2.4) (2,3-bisphosphoglycerate mutase, erythrocyte) (2,3-bisphosphoglycerate synthase) (BPGM) (EC 5.4.2.1) (EC 3.1.3.13) (BPG-dependent PGAM). [Source:Uniprot/SWISSPROT;Acc:P07738]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--K--Y--K--L--I--M--L--R--H--G--E--G--A--W--N--K--E--N--R--F--C--S--W--V--D--Q--K--L--N--S--E--
ATGTCCAAGTACAAACTTATTATGTTAAGACATGGAGAGGGTGCTTGGAATAAGGAGAACCGTTTTTGTAGCTGGGTGGATCAGAAACTCAACAGCGAAG
::::::::::::::::: ::::::::.::::::::::::::::::::::::::.::::::::::::::::::::::::::.::::::::.:::::.::::
ATGTCCAAGTACAAACTGATTATGTTGAGACATGGAGAGGGTGCTTGGAATAAAGAGAACCGTTTTTGTAGCTGGGTGGACCAGAAACTTAACAGTGAAG
-M--S--K--Y--K--L--I--M--L--R--H--G--E--G--A--W--N--K--E--N--R--F--C--S--W--V--D--Q--K--L--N--S--E--

----------------------------------------------------------------------------------------------------
G--M--E--E--A--R--N--C--G--K--Q--L--K--A--L--N--F--E--F--D--L--V--F--T--S--V--L--N--R--S--I--H--T--A
GAATGGAGGAAGCTCGGAACTGTGGGAAGCAACTCAAAGCGTTAAACTTTGAGTTTGATCTTGTATTCACATCTGTCCTTAATCGGTCCATTCACACAGC
:::::::::::::::::::::::::::::::::::::::::.: :::::::::::::::::.::.:::::.::.:::::::::::::::::.::.:::::
GAATGGAGGAAGCTCGGAACTGTGGGAAGCAACTCAAAGCGCTCAACTTTGAGTTTGATCTCGTGTTCACGTCCGTCCTTAATCGGTCCATCCATACAGC
G--M--E--E--A--R--N--C--G--K--Q--L--K--A--L--N--F--E--F--D--L--V--F--T--S--V--L--N--R--S--I--H--T--A

----------------------------------------------------------------------------------------------------
--W--L--I--L--E--E--L--G--Q--E--W--V--P--V--E--S--S--W--R--L--N--E--R--H--Y--G--A--L--I--G--L--N--R-
CTGGCTGATCCTGGAAGAGCTAGGCCAGGAATGGGTGCCTGTGGAAAGCTCCTGGCGTCTAAATGAGCGTCACTATGGGGCCTTGATCGGTCTCAACAGG
:::::::::::::::::::::.:: :::::.::::: ::.:::::::::::::::::::: :::::::::::::::::.:::::::::::::::::::::
CTGGCTGATCCTGGAAGAGCTGGGGCAGGAGTGGGTTCCCGTGGAAAGCTCCTGGCGTCTCAATGAGCGTCACTATGGAGCCTTGATCGGTCTCAACAGG
--W--L--I--L--E--E--L--G--Q--E--W--V--P--V--E--S--S--W--R--L--N--E--R--H--Y--G--A--L--I--G--L--N--R-

----------------------------------------------------------------------------------------------------
-E--Q--M--A--L--N--H--G--E--E--Q--V--R--L--W--R--R--S--Y--N--V--T--P--P--P--I--E--E--S--H--P--Y--Y--
GAGCAGATGGCTTTGAATCATGGTGAAGAACAAGTGAGGCTCTGGAGAAGAAGCTACAATGTAACCCCGCCTCCCATTGAGGAGTCTCATCCTTACTACC
:::::.::::::::::::::.:::::.::.::.:::::::: ::::::::.:::::::::.:::::::.:: ::::::::::::::.:::::::::: ::
GAGCAAATGGCTTTGAATCACGGTGAGGAGCAGGTGAGGCTGTGGAGAAGGAGCTACAATATAACCCCACCGCCCATTGAGGAGTCCCATCCTTACTTCC
-E--Q--M--A--L--N--H--G--E--E--Q--V--R--L--W--R--R--S--Y--N--I--T--P--P--P--I--E--E--S--H--P--Y--F--

----------------------------------------------------------------------------------------------------
Q--E--I--Y--N--D--R--R--Y--K--V--C--D--V--P--L--D--Q--L--P--R--S--E--S--L--K--D--V--L--E--R--L--L--P
AAGAAATCTACAACGACCGGAGGTATAAAGTATGCGATGTGCCCTTGGATCAACTGCCACGGTCGGAAAGCTTAAAGGATGTTCTGGAGAGACTCCTTCC
: :::::::::::::::::::::::.:::::.:::::.:::::.::::::::.:::::.::.:: ::.:::::.::::::::::::::::::::::::::
ACGAAATCTACAACGACCGGAGGTACAAAGTGTGCGACGTGCCTTTGGATCAGCTGCCGCGATCCGAGAGCTTGAAGGATGTTCTGGAGAGACTCCTTCC
H--E--I--Y--N--D--R--R--Y--K--V--C--D--V--P--L--D--Q--L--P--R--S--E--S--L--K--D--V--L--E--R--L--L--P

----------------------------------------------------------------------------------------------------
--Y--W--N--E--R--I--A--P--E--V--L--R--G--K--T--I--L--I--S--A--H--G--N--S--S--R--A--L--L--K--H--L--E-
CTATTGGAATGAAAGGATTGCTCCCGAAGTATTACGTGGCAAAACCATTCTGATATCTGCTCATGGAAATAGCAGTAGGGCACTCCTAAAACACCTGGAA
::::::::::::::::::::::::.::::::::: ::::.::::::::.:::::::::::.::::::::::::::. ::::::::::.:::::.::::::
CTATTGGAATGAAAGGATTGCTCCTGAAGTATTAAGTGGTAAAACCATCCTGATATCTGCCCATGGAAATAGCAGCCGGGCACTCCTGAAACATCTGGAA
--Y--W--N--E--R--I--A--P--E--V--L--S--G--K--T--I--L--I--S--A--H--G--N--S--S--R--A--L--L--K--H--L--E-

><--------------------------------------------------------------------------------------------------
-G--I--S--D--E--D--I--I--N--I--T--L--P--T--G--V--P--I--L--L--E--L--D--E--N--L--R--A--V--G--P--H--Q--
GGTATCTCAGATGAAGACATCATCAACATTACTCTTCCTACTGGAGTCCCCATTCTTCTGGAATTGGATGAAAACCTGCGTGCTGTTGGGCCTCATCAGT
   ::::: :::::.:::::.::::::::.::.:::::::::::.:::::::::::::::::..::::.::.:::::::..::::::::::::::.::::
---ATCTCCGATGAGGACATTATCAACATCACCCTTCCTACTGGGGTCCCCATTCTTCTGGAGCTGGACGAGAACCTGCACGCTGTTGGGCCTCACCAGT
----I--S--D--E--D--I--I--N--I--T--L--P--T--G--V--P--I--L--L--E--L--D--E--N--L--H--A--V--G--P--H--Q--

------------------------------------------------------------------------------->
F--L--G--D--Q--E--A--I--Q--A--A--I--K--K--V--E--D--Q--G--K--V--K--Q--A--K--K--*-
TCCTGGGTGACCAAGAGGCGATCCAAGCAGCCATTAAGAAAGTAGAAGATCAAGGAAAAGTGAAACAAGCTAAAAAATAG
::::::::::::::::::: ::::::::::::::::::::::::::.:::::::::::::::::::.::::.: :::   
TCCTGGGTGACCAAGAGGCTATCCAAGCAGCCATTAAGAAAGTAGAGGATCAAGGAAAAGTGAAACGAGCTGACAAA---
F--L--G--D--Q--E--A--I--Q--A--A--I--K--K--V--E--D--Q--G--K--V--K--R--A--D--K----

Pig Consensus Sequence

>BGISUST0000895300
ATGTCCAAGTACAAACTGATTATGTTGAGACATGGAGAGGGTGCTTGGAATAAAGAGAACCGTTTTTGTAGCTGGGTGGACCAGAAACTTAACAGTGAAG
GAATGGAGGAAGCTCGGAACTGTGGGAAGCAACTCAAAGCGCTCAACTTTGAGTTTGATCTCGTGTTCACGTCCGTCCTTAATCGGTCCATCCATACAGC
CTGGCTGATCCTGGAAGAGCTGGGGCAGGAGTGGGTTCCCGTGGAAAGCTCCTGGCGTCTCAATGAGCGTCACTATGGAGCCTTGATCGGTCTCAACAGG
GAGCAAATGGCTTTGAATCACGGTGAGGAGCAGGTGAGGCTGTGGAGAAGGAGCTACAATATAACCCCACCGCCCATTGAGGAGTCCCATCCTTACTTCC
ACGAAATCTACAACGACCGGAGGTACAAAGTGTGCGACGTGCCTTTGGATCAGCTGCCGCGATCCGAGAGCTTGAAGGATGTTCTGGAGAGACTCCTTCC
CTATTGGAATGAAAGGATTGCTCCTGAAGTATTAAGTGGTAAAACCATCCTGATATCTGCCCATGGAAATAGCAGCCGGGCACTCCTGAAACATCTGGAA
---ATCTCCGATGAGGACATTATCAACATCACCCTTCCTACTGGGGTCCCCATTCTTCTGGAGCTGGACGAGAACCTGCACGCTGTTGGGCCTCACCAGT
TCCTGGGTGACCAAGAGGCTATCCAAGCAGCCATTAAGAAAGTAGAGGATCAAGGAAAAGTGAAACGAGCTGACAAA---


>BGISUSP0000895300
MSKYKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNR
EQMALNHGEEQVRLWRRSYNITPPPIEESHPYFHEIYNDRRYKVCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLSGKTILISAHGNSSRALLKHLE
-ISDEDIINITLPTGVPILLELDENLHAVGPHQFLGDQEAIQAAIKKVEDQGKVKRADK-