Sequences
EST Library Info
cbl4Blood
cmu1Rhinal mucous membrane - RNA from China
dbla2Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000036054 (click for geneview)
Transcript ID ENST00000344949(link to ensembl)
Symbol NP_060779.1
Localtion Chromosome:3:101462546:101525205:1 band: 3q12.2
Description hypothetical protein FLJ11046
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------><----------------------------------------------
-M--A--E--G--E--D--V--P--P--L--P--T--S--S--G--D--G--W--E--K--D--L--E--E--A--L--E--A--G--G--C--D--L--
ATGGCGGAAGGAGAAGATGTGCCGCCGCTGCCAACGTCGAGCGGCGACGGCTGGGAAAAAGATCTTGAAGAAGCTCTGGAAGCAGGAGGTTGTGATCTTG
::::::::::::::::: :: :::::.:.::::::::::::::::::::::   :::::.:::::::::::::::::::: :::::::::::::::::::
ATGGCGGAAGGAGAAGAGGTCCCGCCACCGCCAACGTCGAGCGGCGACGGC---GAAAAGGATCTTGAAGAAGCTCTGGATGCAGGAGGTTGTGATCTTG
-M--A--E--G--E--E--V--P--P--P--P--T--S--S--G--D--G-----E--K--D--L--E--E--A--L--D--A--G--G--C--D--L--

----------------------------------------------------------------><----------------------------------
E--T--L--R--N--I--I--Q--G--R--P--L--P--A--D--L--R--A--K--V--W--K--I--A--L--N--V--A--G--K--G--D--S--L
AAACGTTGAGAAATATAATTCAAGGAAGACCGCTGCCTGCTGATCTGAGGGCCAAAGTTTGGAAGATTGCTCTGAATGTTGCAGGAAAAGGTGATAGTTT
:::: ::::::::::::::::::::.:::::.::::::::::::.:::::::.::::::::::::::::::::.:::::::::::::::::.::::::::
AAACTTTGAGAAATATAATTCAAGGGAGACCACTGCCTGCTGATTTGAGGGCTAAAGTTTGGAAGATTGCTCTAAATGTTGCAGGAAAAGGCGATAGTTT
E--T--L--R--N--I--I--Q--G--R--P--L--P--A--D--L--R--A--K--V--W--K--I--A--L--N--V--A--G--K--G--D--S--L

----------------------------------------------------------------------><----------------------------
--A--S--W--D--G--I--L--D--L--P--E--Q--N--T--I--H--K--D--C--L--Q--F--I--D--Q--L--S--V--P--E--E--K--A-
GGCATCATGGGATGGTATTTTAGACTTGCCAGAACAGAACACTATTCACAAAGATTGCCTGCAGTTTATTGACCAGCTTTCAGTGCCAGAGGAGAAGGCA
:::::: ::::::::::::::::::.:::::::::::::::::::::::::::::::.: : ::::::::   ::::::::::::::.::.:::::::::
GGCATCTTGGGATGGTATTTTAGACCTGCCAGAACAGAACACTATTCACAAAGATTGTCAGGAGTTTATT---CAGCTTTCAGTGCCGGAAGAGAAGGCA
--A--S--W--D--G--I--L--D--L--P--E--Q--N--T--I--H--K--D--C--Q--E--F--I-----Q--L--S--V--P--E--E--K--A-

----------------------------------------------------------------------------------------------------
-A--E--L--L--L--D--I--E--S--V--I--T--F--Y--C--K--S--R--N--I--K--Y--S--T--S--L--S--W--I--H--L--L--K--
GCAGAATTACTTTTGGATATTGAATCTGTAATTACCTTTTATTGTAAATCACGTAACATTAAATATAGCACATCCCTTAGCTGGATACATCTACTGAAAC
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::: ::::
GCAGAATTACTTTTGGATATTGAATCTGTAATTACCTTTTATTGTAAATCACGTAACATTAAATATAGCACGTCCCTTAGCTGGATACATCTACTCAAAC
-A--E--L--L--L--D--I--E--S--V--I--T--F--Y--C--K--S--R--N--I--K--Y--S--T--S--L--S--W--I--H--L--L--K--

---------------------------------------------------------------------------><-----------------------
P--L--V--H--L--Q--L--P--R--S--D--L--Y--N--C--F--Y--A--I--M--N--K--Y--I--P--R--D--C--S--Q--K--G--R--P
CATTGGTGCATCTTCAACTGCCACGCAGCGATTTATACAACTGCTTTTATGCCATAATGAATAAGTACATTCCCAGGGATTGTTCCCAGAAAGGGAGACC
:.::::::::::::::::::::::::::::::::::::::::::::::::::.:: ::::::::::::::::::   :::::::::: :::.::.:::::
CGTTGGTGCATCTTCAACTGCCACGCAGCGATTTATACAACTGCTTTTATGCTATCATGAATAAGTACATTCCC---GATTGTTCCCTGAAGGGAAGACC
P--L--V--H--L--Q--L--P--R--S--D--L--Y--N--C--F--Y--A--I--M--N--K--Y--I--P-----D--C--S--L--K--G--R--P

--------------------------------------------------------------------------------------------------->
--F--H--L--F--R--L--L--I--Q--Y--H--E--P--E--L--C--S--Y--L--D--T--K--K--I--T--P--D--S--Y--A--L--N--W-
ATTTCATCTCTTCAGGTTGCTCATCCAATACCATGAGCCTGAGCTTTGTTCTTATCTTGATACAAAGAAAATTACTCCAGACTCCTATGCACTCAACTGG
:::::::::.::: :.::.:::::::::::::::::::::::::::::::::: ::::::::::::::::::::::::::::::::::::::::::::::
ATTTCATCTTTTCCGATTACTCATCCAATACCATGAGCCTGAGCTTTGTTCTTTTCTTGATACAAAGAAAATTACTCCAGACTCCTATGCACTCAACTGG
--F--H--L--F--R--L--L--I--Q--Y--H--E--P--E--L--C--S--F--L--D--T--K--K--I--T--P--D--S--Y--A--L--N--W-

<---------------------------------------------------------------------------------------------------
-L--G--S--L--F--A--C--Y--C--S--T--E--V--T--Q--A--I--W--D--G--Y--L--Q--Q--A--D--P--F--F--I--Y--F--L--
CTTGGAAGTCTTTTTGCATGTTACTGTTCCACTGAAGTCACTCAGGCAATATGGGATGGATATCTACAACAAGCAGATCCATTTTTTATTTATTTCTTAA
::::::::.::::::::::::::::::::.:.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:
CTTGGAAGCCTTTTTGCATGTTACTGTTCTATTGAAGTCACTCAGGCAATATGGGATGGATATCTACAACAAGCAGATCCATTTTTTATTTATTTCTTGA
-L--G--S--L--F--A--C--Y--C--S--I--E--V--T--Q--A--I--W--D--G--Y--L--Q--Q--A--D--P--F--F--I--Y--F--L--

------------------------><---------------------------------------------><---------------------------
M--L--I--I--L--V--N--A--K--E--V--I--L--T--Q--E--S--D--S--K--E--E--V--I--K--F--L--E--N--T--P--S--S--L
TGTTAATTATCCTTGTTAATGCAAAAGAAGTTATTTTAACACAAGAGTCAGACAGCAAAGAAGAAGTTATCAAGTTCTTGGAAAATACTCCATCCAGTCT
::::::: :::::::::::::::   :::::.::::::.::::.::.:: ::::::::::::::::::      ::::::::::::::::::::::::.:
TGTTAATAATCCTTGTTAATGCA---GAAGTCATTTTAGCACAGGAATCTGACAGCAAAGAAGAAGTT------TTCTTGGAAAATACTCCATCCAGTTT
M--L--I--I--L--V--N--A-----E--V--I--L--A--Q--E--S--D--S--K--E--E--V--------F--L--E--N--T--P--S--S--L

---------------------------------------------------------------------------><-----------------------
--N--I--E--D--I--E--D--L--F--S--L--A--Q--Y--Y--C--S--K--T--P--A--S--F--R--K--D--N--H--H--L--F--G--S-
GAATATAGAAGATATAGAAGACCTTTTCTCTCTGGCTCAGTATTATTGCAGCAAAACACCGGCTTCTTTTAGGAAGGATAATCACCATCTCTTTGGTAGT
:::: :::::::::::::::::::::::::::::::::: :::::::::::.::::::::.::::: :::::::::::::::::::::.: :::::::::
GAATCTAGAAGATATAGAAGACCTTTTCTCTCTGGCTCACTATTATTGCAGTAAAACACCAGCTTCATTTAGGAAGGATAATCACCATTTATTTGGTAGT
--N--L--E--D--I--E--D--L--F--S--L--A--H--Y--Y--C--S--K--T--P--A--S--F--R--K--D--N--H--H--L--F--G--S-

--------------------------------------------------------------------------------------------------><
-T--L--L--G--I--K--D--D--D--A--D--L--S--Q--A--L--C--L--A--I--S--V--S--E--I--L--Q--A--N--Q--L--Q--G--
ACTTTGTTGGGAATTAAGGATGATGATGCAGATCTGAGTCAGGCTCTTTGTCTGGCCATCTCCGTGTCAGAGATCCTTCAAGCGAATCAGCTACAAGGGG
:::::::::::.:::::.:::::.::::: ::::::::::::::::: :::.::::::::::.::::::::::::::::::::.:::::::: :::   :
ACTTTGTTGGGGATTAAAGATGACGATGCTGATCTGAGTCAGGCTCTGTGTTTGGCCATCTCTGTGTCAGAGATCCTTCAAGCAAATCAGCTTCAA---G
-T--L--L--G--I--K--D--D--D--A--D--L--S--Q--A--L--C--L--A--I--S--V--S--E--I--L--Q--A--N--Q--L--Q-----

-------------------------------------------------------------------------------------------><-------
E--G--V--R--F--F--V--V--D--C--R--P--A--E--Q--Y--N--A--G--H--L--S--T--A--F--H--L--D--S--D--L--M--L--Q
AAGGAGTCCGGTTCTTTGTGGTGGATTGCCGTCCTGCAGAACAATATAATGCTGGGCATTTATCAACTGCTTTCCACTTAGATTCAGACCTGATGCTTCA
:::::::::::::::::::::::::::::::::::::.:::::.::::::::::::::::::::::::::::::::::::::::::::.::::::::.::
AAGGAGTCCGGTTCTTTGTGGTGGATTGCCGTCCTGCGGAACAGTATAATGCTGGGCATTTATCAACTGCTTTCCACTTAGATTCAGATCTGATGCTCCA
E--G--V--R--F--F--V--V--D--C--R--P--A--E--Q--Y--N--A--G--H--L--S--T--A--F--H--L--D--S--D--L--M--L--Q

----------------------------------------------------------------------------------------------------
--N--P--S--E--F--A--Q--S--V--K--S--L--L--E--A--Q--K--Q--S--I--E--S--G--S--I--A--G--G--E--H--L--C--F-
GAATCCATCTGAGTTTGCACAGTCAGTAAAATCCTTGCTGGAAGCACAGAAGCAGTCCATTGAGTCTGGCTCCATAGCTGGTGGGGAGCACCTCTGTTTT
:::::::::.:::::::::::::::::::::::::::::::::::.:::::::::::::::::.::. : ..::: :::::.:::::.   ::.:::::.
GAATCCATCCGAGTTTGCACAGTCAGTAAAATCCTTGCTGGAAGCGCAGAAGCAGTCCATTGAATCCCGGCTCATTGCTGGCGGGGAAACACTTTGTTTC
--N--P--S--E--F--A--Q--S--V--K--S--L--L--E--A--Q--K--Q--S--I--E--S--R--L--I--A--G--G--E--T--L--C--F-

--------------------------------------------------------------><------------------------------------
-M--G--S--G--R--E--E--E--D--M--Y--M--N--M--V--L--A--H--F--L--Q--K--N--K--E--Y--V--S--I--A--S--G--G--
ATGGGCAGTGGCAGGGAGGAAGAAGACATGTATATGAACATGGTCCTGGCACACTTTTTACAGAAAAACAAAGAATATGTGAGTATTGCCAGTGGAGGAT
::::::::::::::.:::::.:::::::::::::::::::::::::::::::::::.:::::::::::.::::::::::::::.::::::::::::::::
ATGGGCAGTGGCAGAGAGGAGGAAGACATGTATATGAACATGGTCCTGGCACACTTCTTACAGAAAAATAAAGAATATGTGAGCATTGCCAGTGGAGGAT
-M--G--S--G--R--E--E--E--D--M--Y--M--N--M--V--L--A--H--F--L--Q--K--N--K--E--Y--V--S--I--A--S--G--G--

-----><---------------------------------------------------------------------------------------------
F--M--A--L--Q--Q--H--L--A--D--I--N--V--D--G--P--E--N--G--Y--G--H--W--I--A--S--T--S--G--S--R--S--S--I
TTATGGCACTGCAGCAGCACCTGGCAGACATTAATGTGGATGGACCAGAAAATGGATATGGCCATTGGATTGCTAGTACCTCAGGCTCAAGGAGCAGTAT
:::::   ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
TTATG---CTGCAGCAGCACCTGGCAGACATTAATGTGGATGGACCAGAAAATGGATATGGCCATTGGATTGCTAGTACCTCAGGCTCAAGGAGCAGTAT
F--M-----L--Q--Q--H--L--A--D--I--N--V--D--G--P--E--N--G--Y--G--H--W--I--A--S--T--S--G--S--R--S--S--I

------------><--------------------------------------------------------------------------------------
--N--S--V--D--G--E--S--P--N--G--S--S--D--R--G--M--K--S--L--V--N--K--M--T--V--A--L--K--T--K--S--V--N-
CAATTCTGTTGATGGTGAATCTCCTAATGGCTCAAGTGATAGAGGAATGAAATCACTAGTAAATAAAATGACTGTGGCTTTGAAGACAAAATCCGTTAAT
:: ::::      :::::::::.::::::::::::::::::::::::::::::: :::::::::::::::::::: :::::::::::::::::.::::::
CACTTCT------GGTGAATCTTCTAATGGCTCAAGTGATAGAGGAATGAAATCTCTAGTAAATAAAATGACTGTTGCTTTGAAGACAAAATCTGTTAAT
--T--S--------G--E--S--S--N--G--S--S--D--R--G--M--K--S--L--V--N--K--M--T--V--A--L--K--T--K--S--V--N-

----------------------------------------------------><----------------------------------------------
-V--R--E--K--V--I--S--F--I--E--N--T--S--T--P--V--D--R--H--V--S--S--S--D--R--V--G--K--P--Y--R--G--V--
GTCAGGGAAAAAGTTATCAGTTTTATAGAGAATACATCAACTCCTGTGGATCGGCATGTGAGCAGCAGTGACAGAGTGGGCAAGCCTTACCGTGGCGTAA
:::::::::::::::::::::::::: :::::::::::::::::::::      ::::::::::::::.:::::::::::::::::::::::::::::::
GTCAGGGAAAAAGTTATCAGTTTTATTGAGAATACATCAACTCCTGTG------CATGTGAGCAGCAGCGACAGAGTGGGCAAGCCTTACCGTGGCGTAA
-V--R--E--K--V--I--S--F--I--E--N--T--S--T--P--V--------H--V--S--S--S--D--R--V--G--K--P--Y--R--G--V--

-----------------------------------------><---------------------------------------------------------
K--P--V--F--S--I--G--D--E--E--E--Y--D--T--D--E--I--D--S--S--S--M--S--D--D--D--R--K--E--V--V--N--I--Q
AGCCTGTTTTCAGCATTGGGGATGAAGAAGAATACGACACAGATGAAATTGACAGTTCTTCAATGTCAGATGATGATAGAAAAGAGGTTGTAAACATTCA
::::::::::::::::::::::::::::::::::.::::::   :::::::::::::::::::::::::::::::::::::::::.::::::::::::::
AGCCTGTTTTCAGCATTGGGGATGAAGAAGAATATGACACA---GAAATTGACAGTTCTTCAATGTCAGATGATGATAGAAAAGAAGTTGTAAACATTCA
K--P--V--F--S--I--G--D--E--E--E--Y--D--T-----E--I--D--S--S--S--M--S--D--D--D--R--K--E--V--V--N--I--Q

-----------------------------------------------------------------------------><---------------------
--T--W--I--N--K--P--D--V--K--H--H--F--P--C--K--E--V--K--E--S--G--H--M--F--P--S--H--L--L--V--T--A--T-
GACTTGGATAAACAAACCAGATGTCAAACATCATTTTCCTTGTAAAGAAGTAAAAGAAAGTGGACACATGTTTCCCAGTCATCTGTTGGTTACTGCAACA
:::::::::::::::.:::::::::::.:::::::::::::::::::::::::::::::::::::::::::::      :::::::::::::::::::::
GACTTGGATAAACAAGCCAGATGTCAAGCATCATTTTCCTTGTAAAGAAGTAAAAGAAAGTGGACACATGTTT------CATCTGTTGGTTACTGCAACA
--T--W--I--N--K--P--D--V--K--H--H--F--P--C--K--E--V--K--E--S--G--H--M--F--------H--L--L--V--T--A--T-

----------------------------------------------------------------------------------------------------
-H--M--Y--C--L--R--E--I--V--S--R--K--G--L--A--Y--I--Q--S--R--Q--A--L--N--S--V--V--K--I--T--S--K--K--
CATATGTACTGTTTAAGGGAGATTGTTTCACGGAAAGGATTGGCTTATATACAGTCTCGACAAGCGCTGAATTCTGTAGTTAAAATTACATCCAAAAAAA
:::::::::::::::::::::::: ::::::::::::::::::::::::::::::::::::::::.::.:::::::::::::::::::::::::::::::
CATATGTACTGTTTAAGGGAGATTCTTTCACGGAAAGGATTGGCTTATATACAGTCTCGACAAGCACTAAATTCTGTAGTTAAAATTACATCCAAAAAAA
-H--M--Y--C--L--R--E--I--L--S--R--K--G--L--A--Y--I--Q--S--R--Q--A--L--N--S--V--V--K--I--T--S--K--K--

------------------------------------------------------------------------><--------------------------
K--H--P--E--L--I--T--F--K--Y--G--N--S--S--A--S--G--I--E--I--L--A--I--E--R--Y--L--I--P--N--A--G--D--A
AACATCCTGAACTCATTACCTTCAAGTATGGAAATAGCAGTGCTTCAGGAATAGAAATCTTGGCAATCGAAAGGTATTTGATTCCAAATGCAGGGGATGC
::::::::::..: ::::::::::::::::::::.::::::::::::::::::::::::::::::::.:::   ::::::::::::::::::::.:::::
AACATCCTGAGTTAATTACCTTCAAGTATGGAAACAGCAGTGCTTCAGGAATAGAAATCTTGGCAATTGAA---TATTTGATTCCAAATGCAGGAGATGC
K--H--P--E--L--I--T--F--K--Y--G--N--S--S--A--S--G--I--E--I--L--A--I--E-----Y--L--I--P--N--A--G--D--A

------------------------------------------------------>
--T--K--A--I--K--Q--Q--I--M--K--V--L--D--A--L--E--S--*-
AACTAAAGCCATAAAACAGCAGATCATGAAAGTTTTGGATGCTTTGGAAAGTTAA
 ::.::::::::::::::.::::::::::::::::::::::::::::::::::::
CACCAAAGCCATAAAACAACAGATCATGAAAGTTTTGGATGCTTTGGAAAGTTAA
--T--K--A--I--K--Q--Q--I--M--K--V--L--D--A--L--E--S--*-

Pig Consensus Sequence

>BGISUST0000892369
ATGGCGGAAGGAGAAGAGGTCCCGCCACCGCCAACGTCGAGCGGCGACGGC---GAAAAGGATCTTGAAGAAGCTCTGGATGCAGGAGGTTGTGATCTTG
AAACTTTGAGAAATATAATTCAAGGGAGACCACTGCCTGCTGATTTGAGGGCTAAAGTTTGGAAGATTGCTCTAAATGTTGCAGGAAAAGGCGATAGTTT
GGCATCTTGGGATGGTATTTTAGACCTGCCAGAACAGAACACTATTCACAAAGATTGTCAGGAGTTTATT---CAGCTTTCAGTGCCGGAAGAGAAGGCA
GCAGAATTACTTTTGGATATTGAATCTGTAATTACCTTTTATTGTAAATCACGTAACATTAAATATAGCACGTCCCTTAGCTGGATACATCTACTCAAAC
CGTTGGTGCATCTTCAACTGCCACGCAGCGATTTATACAACTGCTTTTATGCTATCATGAATAAGTACATTCCC---GATTGTTCCCTGAAGGGAAGACC
ATTTCATCTTTTCCGATTACTCATCCAATACCATGAGCCTGAGCTTTGTTCTTTTCTTGATACAAAGAAAATTACTCCAGACTCCTATGCACTCAACTGG
CTTGGAAGCCTTTTTGCATGTTACTGTTCTATTGAAGTCACTCAGGCAATATGGGATGGATATCTACAACAAGCAGATCCATTTTTTATTTATTTCTTGA
TGTTAATAATCCTTGTTAATGCA---GAAGTCATTTTAGCACAGGAATCTGACAGCAAAGAAGAAGTT------TTCTTGGAAAATACTCCATCCAGTTT
GAATCTAGAAGATATAGAAGACCTTTTCTCTCTGGCTCACTATTATTGCAGTAAAACACCAGCTTCATTTAGGAAGGATAATCACCATTTATTTGGTAGT
ACTTTGTTGGGGATTAAAGATGACGATGCTGATCTGAGTCAGGCTCTGTGTTTGGCCATCTCTGTGTCAGAGATCCTTCAAGCAAATCAGCTTCAA---G
AAGGAGTCCGGTTCTTTGTGGTGGATTGCCGTCCTGCGGAACAGTATAATGCTGGGCATTTATCAACTGCTTTCCACTTAGATTCAGATCTGATGCTCCA
GAATCCATCCGAGTTTGCACAGTCAGTAAAATCCTTGCTGGAAGCGCAGAAGCAGTCCATTGAATCCCGGCTCATTGCTGGCGGGGAAACACTTTGTTTC
ATGGGCAGTGGCAGAGAGGAGGAAGACATGTATATGAACATGGTCCTGGCACACTTCTTACAGAAAAATAAAGAATATGTGAGCATTGCCAGTGGAGGAT
TTATG---CTGCAGCAGCACCTGGCAGACATTAATGTGGATGGACCAGAAAATGGATATGGCCATTGGATTGCTAGTACCTCAGGCTCAAGGAGCAGTAT
CACTTCT------GGTGAATCTTCTAATGGCTCAAGTGATAGAGGAATGAAATCTCTAGTAAATAAAATGACTGTTGCTTTGAAGACAAAATCTGTTAAT
GTCAGGGAAAAAGTTATCAGTTTTATTGAGAATACATCAACTCCTGTG------CATGTGAGCAGCAGCGACAGAGTGGGCAAGCCTTACCGTGGCGTAA
AGCCTGTTTTCAGCATTGGGGATGAAGAAGAATATGACACA---GAAATTGACAGTTCTTCAATGTCAGATGATGATAGAAAAGAAGTTGTAAACATTCA
GACTTGGATAAACAAGCCAGATGTCAAGCATCATTTTCCTTGTAAAGAAGTAAAAGAAAGTGGACACATGTTT------CATCTGTTGGTTACTGCAACA
CATATGTACTGTTTAAGGGAGATTCTTTCACGGAAAGGATTGGCTTATATACAGTCTCGACAAGCACTAAATTCTGTAGTTAAAATTACATCCAAAAAAA
AACATCCTGAGTTAATTACCTTCAAGTATGGAAACAGCAGTGCTTCAGGAATAGAAATCTTGGCAATTGAA---TATTTGATTCCAAATGCAGGAGATGC
CACCAAAGCCATAAAACAACAGATCATGAAAGTTTTGGATGCTTTGGAAAGTTAA


>BGISUSP0000892369
MAEGEEVPPPPTSSGDG-EKDLEEALDAGGCDLETLRNIIQGRPLPADLRAKVWKIALNVAGKGDSLASWDGILDLPEQNTIHKDCQEFI-QLSVPEEKA
AELLLDIESVITFYCKSRNIKYSTSLSWIHLLKPLVHLQLPRSDLYNCFYAIMNKYIP-DCSLKGRPFHLFRLLIQYHEPELCSFLDTKKITPDSYALNW
LGSLFACYCSIEVTQAIWDGYLQQADPFFIYFLMLIILVNA-EVILAQESDSKEEV--FLENTPSSLNLEDIEDLFSLAHYYCSKTPASFRKDNHHLFGS
TLLGIKDDDADLSQALCLAISVSEILQANQLQ-EGVRFFVVDCRPAEQYNAGHLSTAFHLDSDLMLQNPSEFAQSVKSLLEAQKQSIESRLIAGGETLCF
MGSGREEEDMYMNMVLAHFLQKNKEYVSIASGGFM-LQQHLADINVDGPENGYGHWIASTSGSRSSITS--GESSNGSSDRGMKSLVNKMTVALKTKSVN
VREKVISFIENTSTPV--HVSSSDRVGKPYRGVKPVFSIGDEEEYDT-EIDSSSMSDDDRKEVVNIQTWINKPDVKHHFPCKEVKESGHMF--HLLVTAT
HMYCLREILSRKGLAYIQSRQALNSVVKITSKKKHPELITFKYGNSSASGIEILAIE-YLIPNAGDATKAIKQQIMKVLDALES*