Sequences
EST Library Info
cov1Ovary - RNA from China
ebs8Foetus 50 days, brain stem
ecc6Foetus 50 days, cortex cerebri
ese2Foetus 50 days, M. semitendinosus
fbs6Unavailable
fhi5Unavailable
hyp4Hypothalamus
relu2Unavailable
ute1Uterus
Clusters
Oligos
SNPs

Gene ID ENSG00000128739 (click for geneview)
Transcript ID ENST00000346403(link to ensembl)
Symbol SNRPN
Localtion Chromosome:15:22619887:22774822:1 band: 15q11.2
Description Small nuclear ribonucleoprotein associated protein N (snRNP-N) (Sm protein N) (Sm-N) (SmN) (Sm-D) (Tissue-specific splicing protein).
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-><------------------------------------------------------------------------------------------------
-M--T--V--G--K--S--S--K--M--L--Q--H--I--D--Y--R--M--R--C--I--L--Q--D--G--R--I--F--I--G--T--F--K--A--
ATGACTGTTGGCAAGAGTAGCAAGATGCTGCAGCACATTGACTATAGAATGAGATGTATCCTGCAAGATGGCCGAATCTTCATTGGCACCTTTAAGGCTT
   ::.:: :: :::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::
---ACCGTGGGAAAGAGCAGCAAGATGCTGCAGCACATTGACTATAGAATGAGATGTATCCTGCAAGATGGCCGGATCTTCATTGGCACCTTTAAGGCTT
----T--V--G--K--S--S--K--M--L--Q--H--I--D--Y--R--M--R--C--I--L--Q--D--G--R--I--F--I--G--T--F--K--A--

------------------------------------------------------><--------------------------------------------
F--D--K--H--M--N--L--I--L--C--D--C--D--E--F--R--K--I--K--P--K--N--A--K--Q--P--E--R--E--E--K--R--V--L
TTGACAAGCATATGAATTTGATCCTCTGTGATTGTGATGAGTTCAGAAAGATCAAGCCAAAGAATGCGAAGCAACCAGAGCGTGAAGAAAAGCGGGTTTT
::::::::::::::::.:::::::::::::::::::::::.:::::.::::::   ::::::::.::.:::::.::::::::::::::::::::::::::
TTGACAAGCATATGAACTTGATCCTCTGTGATTGTGATGAATTCAGGAAGATC---CCAAAGAACGCAAAGCAGCCAGAGCGTGAAGAAAAGCGGGTTTT
F--D--K--H--M--N--L--I--L--C--D--C--D--E--F--R--K--I-----P--K--N--A--K--Q--P--E--R--E--E--K--R--V--L

------------------------------------------------------------------><--------------------------------
--G--L--V--L--L--R--G--E--N--L--V--S--M--T--V--E--G--P--P--P--K--D--T--G--I--A--R--V--P--L--A--G--A-
GGGTCTGGTGTTGCTGCGTGGGGAGAACTTGGTATCCATGACTGTGGAGGGGCCACCCCCCAAAGATACTGGCATTGCTCGGGTACCACTTGCTGGAGCT
::::::::::::::::::::::::.::.::::: :::::::::::::::::.:::::::::::::::::::: :::::::: ::::::::::::::::::
GGGTCTGGTGTTGCTGCGTGGGGAAAATTTGGTTTCCATGACTGTGGAGGGACCACCCCCCAAAGATACTGGAATTGCTCGTGTACCACTTGCTGGAGCT
--G--L--V--L--L--R--G--E--N--L--V--S--M--T--V--E--G--P--P--P--K--D--T--G--I--A--R--V--P--L--A--G--A-

----------------------------------------------------------------------------------------------------
-A--G--G--P--G--V--G--R--A--A--G--R--G--V--P--A--G--V--P--I--P--Q--A--P--A--G--L--A--G--P--V--R--G--
GCTGGAGGCCCTGGGGTTGGTAGGGCAGCTGGTAGAGGAGTACCAGCTGGTGTGCCAATTCCCCAGGCCCCTGCTGGATTGGCAGGCCCTGTCCGAGGAG
:: :::::::::::::::::.:::::::::::.::::: :::::::::::::: :::::::::::::: :::::::::::.:::::.:::::::::::.:
GCAGGAGGCCCTGGGGTTGGCAGGGCAGCTGGCAGAGGTGTACCAGCTGGTGTTCCAATTCCCCAGGCACCTGCTGGATTAGCAGGTCCTGTCCGAGGGG
-A--G--G--P--G--V--G--R--A--A--G--R--G--V--P--A--G--V--P--I--P--Q--A--P--A--G--L--A--G--P--V--R--G--

-------------------><-------------------------------------------------------------------------------
V--G--G--P--S--Q--Q--V--M--T--P--Q--G--R--G--T--V--A--A--A--A--V--A--A--T--A--S--I--A--G--A--P--T--Q
TTGGGGGACCATCCCAGCAGGTAATGACTCCACAGGGAAGAGGCACTGTAGCAGCTGCTGCTGTTGCTGCGACTGCCAGTATTGCTGGAGCCCCAACACA
:::::::.::::::::.:::::::::::.::::::::::::::::::::::: :::::::: :::::::: ::::::::.::::::::::::::::: ::
TTGGGGGGCCATCCCAACAGGTAATGACCCCACAGGGAAGAGGCACTGTAGCTGCTGCTGCAGTTGCTGCTACTGCCAGCATTGCTGGAGCCCCAACTCA
V--G--G--P--S--Q--Q--V--M--T--P--Q--G--R--G--T--V--A--A--A--A--V--A--A--T--A--S--I--A--G--A--P--T--Q

----------------------------------------------------------><----------------------------------------
--Y--P--P--G--R--G--T--P--P--P--P--V--G--R--A--T--P--P--P--G--I--M--A--P--P--P--G--M--R--P--P--M--G-
GTACCCACCAGGACGGGGCACTCCGCCCCCACCCGTCGGCAGAGCAACCCCACCTCCAGGCATTATGGCTCCTCCACCTGGTATGAGACCACCCATGGGC
:::.:::::::: ::::: :::::.::: ::::.::.::. :::::::::::::::::   :::::::::::::::::::::::::::::::: ::::::
GTATCCACCAGGCCGGGGGACTCCACCCACACCTGTTGGTCGAGCAACCCCACCTCCA---ATTATGGCTCCTCCACCTGGTATGAGACCACCAATGGGC
--Y--P--P--G--R--G--T--P--P--T--P--V--G--R--A--T--P--P--P-----I--M--A--P--P--P--G--M--R--P--P--M--G-

------------------------------------------------------------------------------------><--------------
-P--P--I--G--L--P--P--A--R--G--T--P--I--G--M--P--P--P--G--M--R--P--P--P--P--G--I--R--G--P--P--P--P--
CCACCAATTGGGCTTCCCCCTGCTCGAGGGACGCCAATAGGCATGCCGCCTCCGGGAATGAGACCCCCTCCACCAGGCATTAGAGGTCCACCTCCCCCAG
::::::::.::.:::::.:::.::::::::::::::::::::::::: :::::.::::::::::::::::::::::: ::::::   :::::::::::::
CCACCAATCGGACTTCCTCCTACTCGAGGGACGCCAATAGGCATGCCCCCTCCAGGAATGAGACCCCCTCCACCAGGAATTAGA---CCACCTCCCCCAG
-P--P--I--G--L--P--P--T--R--G--T--P--I--G--M--P--P--P--G--M--R--P--P--P--P--G--I--R-----P--P--P--P--

---------------------->
G--M--R--P--P--R--P--*-
GAATGCGTCCACCAAGACCTTAG
:::::::::::::::::::.:::
GAATGCGTCCACCAAGACCCTAG
G--M--R--P--P--R--P--*-

Pig Consensus Sequence

>BGISUST0000895748
---ACCGTGGGAAAGAGCAGCAAGATGCTGCAGCACATTGACTATAGAATGAGATGTATCCTGCAAGATGGCCGGATCTTCATTGGCACCTTTAAGGCTT
TTGACAAGCATATGAACTTGATCCTCTGTGATTGTGATGAATTCAGGAAGATC---CCAAAGAACGCAAAGCAGCCAGAGCGTGAAGAAAAGCGGGTTTT
GGGTCTGGTGTTGCTGCGTGGGGAAAATTTGGTTTCCATGACTGTGGAGGGACCACCCCCCAAAGATACTGGAATTGCTCGTGTACCACTTGCTGGAGCT
GCAGGAGGCCCTGGGGTTGGCAGGGCAGCTGGCAGAGGTGTACCAGCTGGTGTTCCAATTCCCCAGGCACCTGCTGGATTAGCAGGTCCTGTCCGAGGGG
TTGGGGGGCCATCCCAACAGGTAATGACCCCACAGGGAAGAGGCACTGTAGCTGCTGCTGCAGTTGCTGCTACTGCCAGCATTGCTGGAGCCCCAACTCA
GTATCCACCAGGCCGGGGGACTCCACCCACACCTGTTGGTCGAGCAACCCCACCTCCA---ATTATGGCTCCTCCACCTGGTATGAGACCACCAATGGGC
CCACCAATCGGACTTCCTCCTACTCGAGGGACGCCAATAGGCATGCCCCCTCCAGGAATGAGACCCCCTCCACCAGGAATTAGA---CCACCTCCCCCAG
GAATGCGTCCACCAAGACCCTAG


>BGISUSP0000895748
-TVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKI-PKNAKQPEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGA
AGGPGVGRAAGRGVPAGVPIPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAVAATASIAGAPTQYPPGRGTPPTPVGRATPPP-IMAPPPGMRPPMG
PPIGLPPTRGTPIGMPPPGMRPPPPGIR-PPPPGMRPPRP*