Sequences
BP160788est
reru14c_d8.y1est
reep10c_p7.y1est
rcga37b_p17.y1est
rton1204b_h16.y1est
relu1302b_l11.y1est
rnmm25c_e22.y1est
rcki21_p23.y1est
rpigcb_10315.y1est
rbdd_9119.y1reads
bdc_52068.z1reads
rmcp17c_o8.y1est
BM675828est
rhea17_e5.y1est
reep30c_e22.y1est
ruio26_n5.y1est
CB287729est
DN119806est
CV870928est
CJ018446est
rjej33b_e3.y1est
reje33b_c10.y1est
BP151011est
rcly36b_l22.y1est
BP163673est
DN117165est
BW963405est
rdbla0105_g18.y1est
rpigcb_11132.y1est
rnco1916b_p21.y1est
BW958016est
CJ018495est
rpldo0107_f16.y1est
CF175505est
rsme016_c18.y1est
CF722588est
rsme013_i11.y1est
rpigcb_0265.y1est
bdc_49109.z1reads
rcut16_e14.y1est
rese26c_h8.y1est
rjej34b_p18.y1est
rspl12_b4.y1est
CR882462reads
rsme37_n11.y1est
rplac_6625.y1est
reje31b_h9.y1est
rvin037_o17.y1est
rpigcb_16994.y1est
rcki35_g9.y1est
BI183914est
reje16b_c5.y1est
bdc_55870.z1reads
DN122909est
rski0119_e19.y1est
rmed09c_p17.y1est
rski0115_k16.y1est
rcut19_n6.y1est
rbdc_55870.y1reads
BP457043est
rese16c_n19.y1est
rret07_n7.y1est
rebs33c_c6.y1est
rcbe25_p16.y1est
rplun0138_m17.y1est
rnje06c_b12.y1est
rche14_h1.y1est
reep20c_n12.y1est
rcst32_g24.y1est
CR901553reads
BW977893est
DN119224est
rcst03_j14.y1est
BP167715est
DY433246est
rcki03_d22.y1est
rste17_e16.y1est
CF176844est
rpigca_010064.y1est
bdc_56182.z1reads
rbdc_49109.y1reads
CB286162est
rche21_o17.y1est
rbde_81774.y1reads
rmcp34c_g7.y1est
rssp01_g14.y1est
rmed23c_l10.y1est
rese25c_b22.y1est
DN103077est
BW955652est
dpbxa0_039120.z1reads
AJ945957est
rpigca_0974.y1est
CJ019321est
DN117517est
BP172535est
BP439299est
CR901851reads
rebs33c_n7.y1est
rpigcb_1696.y1est
relu1315b_m10r1.y1est
rpigcb_8727.y1est
rpgl02_p15.y1est
DY431214est
rski0137_h17.y1est
recc2816c_j9.y1est
rspl02_p19.y1est
CK467923est
DN117812est
relu1301b_p21r1.y1est
BI186308est
rpigca0_001885.y1est
rpldo0132_b18.y1est
rcut16_e18.y1est
Z84131est
rpldo0117_d5.y1est
rton1209b_o11.y1est
AJ661177est
recc2814c_d24.y1est
BP455396est
rton1232b_k1.y1est
rmcp22c_i16.y1est
rpldo0107_i18.y1est
DV224663est
rblb_9720.y1reads
rcbl0_007396.y1est
bde_88092.z1reads
DN120534est
rcut17_p4.y1est
DN117461est
recc2805c_f13.y1est
CO939520est
CV875400est
BP457924est
relu1328c_p22.y1est
DV229986est
reep21c_d11.y1est
EST Library Info
cbe3Cerebellum
cbl3Blood
che4Heart - RNA from China
cki3Kidney - RNA from China
cly1Lymph - RNA from China
cst3Stomach - RNA from China
cut2Uterus - RNA from China
dbla2Unavailable
ebs4Foetus 50 days, brain stem
ecc3Foetus 50 days, cortex cerebri
eep6Foetus 50 days, epidermis
eje6Foetus 50 days, jejunum
eru2Foetus 50 days, regio umbilicalis
ese5Foetus 50 days, M. semitendinosus
jej2Small intestine, jejunum
mcp7Mammae, collostrum producing
med5Mediastinum
nco1Newborn 115 days, colon
nje1Newborn 115 days, jejunum
nmm1Newborn 115 days, mucosal membranes
pgl2Pituitary gland
pigca5Unavailable
pigcb10Unavailable
plac3Unavailable
pldo7Unavailable
relu8Unavailable
ret1Retina
ski3Skin
sme1M. Semimembranosus
spl3Spleen
ssp3M. Supraspinatus
ste2M. Semitendinosus
ton3Tip of tongue, mucosal membrane
uio2Unavailable
vin1M. Vastus intermedius
Clusters
Oligos
SNPs

Gene ID ENSG00000168036 (click for geneview)
Transcript ID ENST00000349496(link to ensembl)
Symbol CTNNB1
Localtion Chromosome:3:41216004:41256938:1 band: 3p22.1
Description Beta-catenin. [Source:Uniprot/SWISSPROT;Acc:P35222]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----------><--------------------------------------------------------------------------------------
-M--A--T--Q--A--D--L--M--E--L--D--M--A--M--E--P--D--R--K--A--A--V--S--H--W--Q--Q--Q--S--Y--L--D--S--
ATGGCTACTCAAGCTGATTTGATGGAGTTGGACATGGCCATGGAACCAGACAGAAAAGCGGCTGTTAGTCACTGGCAGCAACAGTCTTACCTGGACTCTG
               ::::::::::::.::::::::::.:::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::
---------------GATTTGATGGAGCTGGACATGGCTATGGAGCCAGACAGAAAAGCGGCTGTTAGTCACTGGCAGCAACAGTCTTACCTGGACTCTG
----------------D--L--M--E--L--D--M--A--M--E--P--D--R--K--A--A--V--S--H--W--Q--Q--Q--S--Y--L--D--S--

----------------------------------------------------------------------------------------------------
G--I--H--S--G--A--T--T--T--A--P--S--L--S--G--K--G--N--P--E--E--E--D--V--D--T--S--Q--V--L--Y--E--W--E
GAATCCATTCTGGTGCCACTACCACAGCTCCTTCTCTGAGTGGTAAAGGCAATCCTGAGGAAGAGGATGTGGATACCTCCCAAGTCCTGTATGAGTGGGA
::::::::::::::::::: :::::::::::::::::.::::::::::::::::::::.:::::::::::::::::: ::::::::::.:::::::::::
GAATCCATTCTGGTGCCACGACCACAGCTCCTTCTCTAAGTGGTAAAGGCAATCCTGAAGAAGAGGATGTGGATACCACCCAAGTCCTATATGAGTGGGA
G--I--H--S--G--A--T--T--T--A--P--S--L--S--G--K--G--N--P--E--E--E--D--V--D--T--T--Q--V--L--Y--E--W--E

----------------------------------------><----------------------------------------------------------
--Q--G--F--S--Q--S--F--T--Q--E--Q--V--A--D--I--D--G--Q--Y--A--M--T--R--A--Q--R--V--R--A--A--M--F--P-
ACAGGGATTTTCTCAGTCCTTCACTCAAGAACAAGTAGCTGATATTGATGGACAGTATGCAATGACTCGAGCTCAGAGGGTACGAGCTGCTATGTTCCCT
.:::::::::::::::::::::::::::::::::::.:::   :::::::::::::::::::::::::: ::::::::::::::::::::::::::::::
GCAGGGATTTTCTCAGTCCTTCACTCAAGAACAAGTGGCT---ATTGATGGACAGTATGCAATGACTCGCGCTCAGAGGGTACGAGCTGCTATGTTCCCT
--Q--G--F--S--Q--S--F--T--Q--E--Q--V--A-----I--D--G--Q--Y--A--M--T--R--A--Q--R--V--R--A--A--M--F--P-

----------------------------------------------------------------------------------------------------
-E--T--L--D--E--G--M--Q--I--P--S--T--Q--F--D--A--A--H--P--T--N--V--Q--R--L--A--E--P--S--Q--M--L--K--
GAGACATTAGATGAGGGCATGCAGATCCCATCTACACAGTTTGATGCTGCTCATCCCACTAATGTCCAGCGTTTGGCTGAACCATCACAGATGCTGAAAC
::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::.:::::::::::::::::::::::::::
GAGACATTAGATGAGGGCATGCAGATCCCATCTACACAGTTTGACGCTGCTCATCCCACTAATGTCCAGCGTCTGGCTGAACCATCACAGATGCTGAAAC
-E--T--L--D--E--G--M--Q--I--P--S--T--Q--F--D--A--A--H--P--T--N--V--Q--R--L--A--E--P--S--Q--M--L--K--

----------------------------------------------------------------------------------------------><----
H--A--V--V--N--L--I--N--Y--Q--D--D--A--E--L--A--T--R--A--I--P--E--L--T--K--L--L--N--D--E--D--Q--V--V
ATGCAGTTGTAAACTTGATTAACTATCAAGATGATGCAGAACTTGCCACACGTGCAATCCCTGAACTGACAAAACTGCTAAATGACGAGGACCAGGTGGT
:::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::.:::.::::::::.::::::::::.::.::::::::.::
ATGCAGTTGTAAATTTGATTAACTATCAAGATGATGCAGAACTTGCCACACGTGCAATCCCCGAATTGACAAAATTGCTAAATGATGAAGACCAGGTAGT
H--A--V--V--N--L--I--N--Y--Q--D--D--A--E--L--A--T--R--A--I--P--E--L--T--K--L--L--N--D--E--D--Q--V--V

----------------------------------------------------------------------------------------------------
--V--N--K--A--A--V--M--V--H--Q--L--S--K--K--E--A--S--R--H--A--I--M--R--S--P--Q--M--V--S--A--I--V--R-
GGTTAATAAGGCTGCAGTTATGGTCCATCAGCTTTCTAAAAAGGAAGCTTCCAGACACGCTATCATGCGTTCTCCTCAGATGGTGTCTGCTATTGTACGT
::: ::::::::::::::::::::::::::::::::.::::::::::::::::::::.::.::::::::::::::::::::::::::::: :::::::::
GGTGAATAAGGCTGCAGTTATGGTCCATCAGCTTTCCAAAAAGGAAGCTTCCAGACATGCCATCATGCGTTCTCCTCAGATGGTGTCTGCAATTGTACGT
--V--N--K--A--A--V--M--V--H--Q--L--S--K--K--E--A--S--R--H--A--I--M--R--S--P--Q--M--V--S--A--I--V--R-

----------------------------------------------------------------------------------------------------
-T--M--Q--N--T--N--D--V--E--T--A--R--C--T--A--G--T--L--H--N--L--S--H--H--R--E--G--L--L--A--I--F--K--
ACCATGCAGAATACAAATGATGTAGAAACAGCTCGTTGTACCGCTGGGACCTTGCATAACCTTTCCCATCATCGTGAGGGCTTACTGGCCATCTTTAAGT
:::::::::::::::::::::::::::::.:::::.:::::.::::::::::::::.::.:::::::::::::::::::::::.::::::::::::::.:
ACCATGCAGAATACAAATGATGTAGAAACGGCTCGCTGTACTGCTGGGACCTTGCACAATCTTTCCCATCATCGTGAGGGCTTGCTGGCCATCTTTAAAT
-T--M--Q--N--T--N--D--V--E--T--A--R--C--T--A--G--T--L--H--N--L--S--H--H--R--E--G--L--L--A--I--F--K--

---------------------------------><-----------------------------------------------------------------
S--G--G--I--P--A--L--V--K--M--L--G--S--P--V--D--S--V--L--F--Y--A--I--T--T--L--H--N--L--L--L--H--Q--E
CTGGAGGCATTCCTGCCCTGGTGAAAATGCTTGGTTCACCAGTGGATTCTGTGTTGTTTTATGCCATTACAACTCTCCACAACCTTTTATTACATCAAGA
::::.::::::::::::::.:::::.::::::   :::::::::::::::::.:::::::::::::::::::::::.::::::::::::::.:::::.::
CTGGGGGCATTCCTGCCCTAGTGAAGATGCTT---TCACCAGTGGATTCTGTATTGTTTTATGCCATTACAACTCTTCACAACCTTTTATTGCATCAGGA
S--G--G--I--P--A--L--V--K--M--L-----S--P--V--D--S--V--L--F--Y--A--I--T--T--L--H--N--L--L--L--H--Q--E

----------------------------------------------------------------------------------------------------
--G--A--K--M--A--V--R--L--A--G--G--L--Q--K--M--V--A--L--L--N--K--T--N--V--K--F--L--A--I--T--T--D--C-
AGGAGCTAAAATGGCAGTGCGTTTAGCTGGTGGGCTGCAGAAAATGGTTGCCTTGCTCAACAAAACAAATGTTAAATTCTTGGCTATTACGACAGACTGC
::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::
AGGAGCTAAAATGGCAGTGCGTTTAGCTGGCGGGCTGCAGAAAATGGTTGCCTTGCTCAACAAAACAAATGTTAAATTCTTGGCTATTACAACAGACTGC
--G--A--K--M--A--V--R--L--A--G--G--L--Q--K--M--V--A--L--L--N--K--T--N--V--K--F--L--A--I--T--T--D--C-

-----------------------------------><---------------------------------------------------------------
-L--Q--I--L--A--Y--G--N--Q--E--S--K--L--I--I--L--A--S--G--G--P--Q--A--L--V-----N--I--M--R--T--Y--T--
CTTCAAATTTTAGCTTATGGCAACCAAGAAAGCAAGCTCATCATACTGGCTAGTGGTGGACCCCAAGCTTTAGTA---AATATAATGAGGACCTATACTT
:::::.:::::::::::.:::::.:::::::::::::: ::::: :::::::::::::::::.:::::::::::.   :.:::::::::::::::.::::
CTTCAGATTTTAGCTTACGGCAATCAAGAAAGCAAGCTGATCATTCTGGCTAGTGGTGGACCTCAAGCTTTAGTGA--AGTATAATGAGGACCTACACTT
-L--Q--I--L--A--Y--G--N--Q--E--S--K--L--I--I--L--A--S--G--G--P--Q--A--L--V--\--N--I--M--R--T--Y--T--

-----------------------------------------------------------------------------------><---------------
Y--E--K--L--L--W--T--T--S--R--V--L--K--V--L--S--V--C--S--S--N--K--P--A--I--V--E--A--G--G--M--Q--A--L
ACGAAAAACTACTGTGGACCACAAGCAGAGTGCTGAAGGTGCTATCTGTCTGCTCTAGTAATAAGCCGGCTATTGTAGAAGCTGGTGGAATGCAAGCTTT
:.::.::::::::::::::::::::: ::::.::::::::::: :::::::::::::::::::::::.:::::::::::::::   ::::::::::::::
ATGAGAAACTACTGTGGACCACAAGCCGAGTACTGAAGGTGCTCTCTGTCTGCTCTAGTAATAAGCCAGCTATTGTAGAAGCT---GGAATGCAAGCTTT
Y--E--K--L--L--W--T--T--S--R--V--L--K--V--L--S--V--C--S--S--N--K--P--A--I--V--E--A-----G--M--Q--A--L

---------------------------------------------------------------------------------------><-----------
--G--L--H--L--T--D--P--S--Q--R--L--V--Q--N--C--L--W--T--L--R--N--L--S--D--A--A--T--K--Q--E--G--M--E-
AGGACTTCACCTGACAGATCCAAGTCAACGTCTTGTTCAGAACTGTCTTTGGACTCTCAGGAATCTTTCAGATGCTGCAACTAAACAGGAAGGGATGGAA
:::::::::.:::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::
AGGACTTCATCTGACAGATCCAAGTCAACGTCTTGTTCAGAACTGTCTTTGGACTCTTAGGAATCTTTCAGATGCTGCAACTAAACAGGAAGGGATGGAA
--G--L--H--L--T--D--P--S--Q--R--L--V--Q--N--C--L--W--T--L--R--N--L--S--D--A--A--T--K--Q--E--G--M--E-

----------------------------------------------------------------------------------------------------
-G--L--L--G--T--L--V--Q--L--L--G--S--D--D--I--N--V--V--T--C--A--A--G--I--L--S--N--L--T--C--N--N--Y--
GGTCTCCTTGGGACTCTTGTTCAGCTTCTGGGTTCAGATGATATAAATGTGGTCACCTGTGCAGCTGGAATTCTTTCTAACCTCACTTGCAATAATTATA
:::::.::::::::.:::::::::::::::::.::.:::::::::::::::::.::::::::::::::::::::::::::.:::::::::::::::::::
GGTCTTCTTGGGACCCTTGTTCAGCTTCTGGGCTCGGATGATATAAATGTGGTTACCTGTGCAGCTGGAATTCTTTCTAATCTCACTTGCAATAATTATA
-G--L--L--G--T--L--V--Q--L--L--G--S--D--D--I--N--V--V--T--C--A--A--G--I--L--S--N--L--T--C--N--N--Y--

----------------------------------------------------------------------------------------------------
K--N--K--M--M--V--C--Q--V--G--G--I--E--A--L--V--R--T--V--L--R--A--G--D--R--E--D--I--T--E--P--A--I--C
AGAACAAGATGATGGTCTGCCAAGTGGGTGGTATAGAGGCTCTTGTGCGTACTGTCCTTCGGGCTGGTGACAGGGAAGACATCACTGAGCCTGCCATCTG
:.:::::::::::::: :::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::.:::::::::::.:::::::::::
AAAACAAGATGATGGTGTGCCAAGTGGGTGGTATAGAGGCTCTTGTGCGTACTGTCCTTCGTGCTGGTGACAGGGAGGACATCACTGAACCTGCCATCTG
K--N--K--M--M--V--C--Q--V--G--G--I--E--A--L--V--R--T--V--L--R--A--G--D--R--E--D--I--T--E--P--A--I--C

----------------------------------------------------------------------------------------------------
--A--L--R--H--L--T--S--R--H--Q--E--A--E--M--A--Q--N--A--V--R--L--H--Y--G--L--P--V--V--V--K--L--L--H-
TGCTCTTCGTCATCTGACCAGCCGACACCAAGAAGCAGAGATGGCCCAGAATGCAGTTCGCCTTCACTATGGACTACCAGTTGTGGTTAAGCTCTTACAC
::::::.:::::::::::::::::::::::.::::: ::::::::::::::::: ::::::::::::::.::::::::::::::::::::.:::.::::.
TGCTCTCCGTCATCTGACCAGCCGACACCAGGAAGCTGAGATGGCCCAGAATGCTGTTCGCCTTCACTACGGACTACCAGTTGTGGTTAAACTCCTACAT
--A--L--R--H--L--T--S--R--H--Q--E--A--E--M--A--Q--N--A--V--R--L--H--Y--G--L--P--V--V--V--K--L--L--H-

--------------------------><------------------------------------------------------------------------
-P--P--S--H--W--P--L--I--K--A--T--V--G--L--I--R--N--L--A--L--C--P--A--N--H--A--P--L--R--E--Q--G--A--
CCACCATCCCACTGGCCTCTGATAAAGGCTACTGTTGGATTGATTCGAAATCTTGCCCTTTGTCCCGCAAATCATGCACCTTTGCGTGAGCAGGGTGCCA
:::::::::::.:::::::: :: ::::::::.:::::::::::::::::::::::::::::::: :::::::::::::::::::: :::::::::::::
CCACCATCCCATTGGCCTCTCATCAAGGCTACCGTTGGATTGATTCGAAATCTTGCCCTTTGTCCAGCAAATCATGCACCTTTGCGAGAGCAGGGTGCCA
-P--P--S--H--W--P--L--I--K--A--T--V--G--L--I--R--N--L--A--L--C--P--A--N--H--A--P--L--R--E--Q--G--A--

-------------------------------------------------------------------------------------><-------------
I--P--R--L--V--Q--L--L--V--R--A--H--Q--D--T--Q--R--R--T--S--M--G--G--T--Q--Q--Q--F--V--E--G--V--R--M
TTCCACGACTAGTTCAGTTGCTTGTTCGTGCACATCAGGATACCCAGCGCCGTACGTCCATGGGTGGGACACAGCAGCAATTTGTGGAGGGGGTCCGCAT
:::::::::::::::::::::: :::::::: :::::::::::::::::::::::::::::::::::.::::::::.::.::::::::::::::::::::
TTCCACGACTAGTTCAGTTGCTGGTTCGTGCTCATCAGGATACCCAGCGCCGTACGTCCATGGGTGGAACACAGCAACAGTTTGTGGAGGGGGTCCGCAT
I--P--R--L--V--Q--L--L--V--R--A--H--Q--D--T--Q--R--R--T--S--M--G--G--T--Q--Q--Q--F--V--E--G--V--R--M

----------------------------------------------------------------------------------------------------
--E--E--I--V--E--G--C--T--G--A--L--H--I--L--A--R--D--V--H--N--R--I--V--I--R--G--L--N--T--I--P--L--F-
GGAAGAAATAGTTGAAGGTTGTACCGGAGCCCTTCACATCCTAGCTCGGGATGTTCACAACCGAATTGTTATCAGAGGACTAAATACCATTCCATTGTTT
::::::::::::::::::::::::.:::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GGAAGAAATAGTTGAAGGTTGTACTGGAGCCCTTCATATCCTAGCTCGGGATGTTCACAACCGAATTGTTATCAGAGGACTAAATACCATTCCATTGTTT
--E--E--I--V--E--G--C--T--G--A--L--H--I--L--A--R--D--V--H--N--R--I--V--I--R--G--L--N--T--I--P--L--F-

-----><---------------------------------------------------------------------------------------------
-V--Q--L--L--Y--S--P--I--E--N--I--Q--R--V--A--A--G--V--L--C--E--L--A--Q--D--K--E--A--A--E--A--I--E--
GTGCAGCTGCTTTATTCTCCCATTGAAAACATCCAAAGAGTAGCTGCAGGGGTCCTCTGTGAACTTGCTCAGGACAAGGAAGCTGCAGAAGCTATTGAAG
:::::::::::::::::::::::.:::::.::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::
GTGCAGCTGCTTTATTCTCCCATCGAAAATATCCAAAGAGTAGCTGCAGGGGTCCTCTGTGAACTTGCTCAGGACAAGGAGGCTGCAGAAGCTATTGAAG
-V--Q--L--L--Y--S--P--I--E--N--I--Q--R--V--A--A--G--V--L--C--E--L--A--Q--D--K--E--A--A--E--A--I--E--

--------------------------------------------------------><------------------------------------------
A--E--G--A--T--A--P--L--T--E--L--L--H--S--R--N--E--G--V--A--T--Y--A--A--A--V--L--F--R--M--S--E--D--K
CTGAGGGAGCCACAGCTCCTCTGACAGAGTTACTTCACTCTAGGAATGAAGGTGTGGCGACATATGCAGCTGCTGTTTTGTTCCGAATGTCTGAGGACAA
:::::::::::::::: :::::::::::.:::::.:::::::::::::::::::::   :::::.:::::::::::::::::::::::::::::::::::
CTGAGGGAGCCACAGCACCTCTGACAGAATTACTCCACTCTAGGAATGAAGGTGTG---ACATACGCAGCTGCTGTTTTGTTCCGAATGTCTGAGGACAA
A--E--G--A--T--A--P--L--T--E--L--L--H--S--R--N--E--G--V-----T--Y--A--A--A--V--L--F--R--M--S--E--D--K

------------------------------------------------------------------------------><--------------------
--P--Q--D--Y--K--K--R--L--S--V--E--L--T--S--S--L--F--R--T--E--P--M--A--W--N--E--T--A--D--L--G--L--D-
GCCACAAGATTACAAGAAACGGCTTTCAGTTGAGCTGACCAGCTCTCTCTTCAGAACAGAGCCAATGGCTTGGAATGAGACTGCTGATCTTGGACTTGAT
::: ::.:::::.::::::::::::::.::::::::::::::.:::::.:::::::::::::::::::::::::::::::::::::::::::::::::::
GCCCCAGGATTATAAGAAACGGCTTTCGGTTGAGCTGACCAGTTCTCTTTTCAGAACAGAGCCAATGGCTTGGAATGAGACTGCTGATCTTGGACTTGAT
--P--Q--D--Y--K--K--R--L--S--V--E--L--T--S--S--L--F--R--T--E--P--M--A--W--N--E--T--A--D--L--G--L--D-

---------------------------------------><-----------------------------------------------------------
-I--G--A--Q--G--E--P--L--G--Y--R--Q--D--D--P--S--Y--R--S--F--H--S--G--G--Y--G--Q--D--A--L--G--M--D--
ATTGGTGCCCAGGGAGAACCCCTTGGATATCGCCAGGATGATCCTAGCTATCGTTCTTTTCACTCTGGTGGATATGGCCAGGATGCCTTGGGTATGGACC
:::::::::::::::::::::::::::::::::::::::   ::.:::::::::::::::::::::::::::::.:::::::::::::::::::::::::
ATTGGTGCCCAGGGAGAACCCCTTGGATATCGCCAGGAT---CCCAGCTATCGTTCTTTTCACTCTGGTGGATACGGCCAGGATGCCTTGGGTATGGACC
-I--G--A--Q--G--E--P--L--G--Y--R--Q--D-----P--S--Y--R--S--F--H--S--G--G--Y--G--Q--D--A--L--G--M--D--

----------------------------------------------------------------------------------------------------
P--M--M--E--H--E--M--G--G--H--H--P--G--A--D--Y--P--V--D--G--L--P--D--L--G--H--A--Q--D--L--M--D--G--L
CCATGATGGAACATGAGATGGGTGGCCACCACCCTGGTGCTGACTATCCAGTTGATGGGCTGCCAGATCTGGGGCATGCCCAGGACCTCATGGATGGGCT
::::::::::.:::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCATGATGGAGCATGAGATGGGTGGCCACCACCCCGGTGCTGACTATCCAGTTGATGGGCTGCCAGATCTGGGGCATGCCCAGGACCTCATGGATGGGCT
P--M--M--E--H--E--M--G--G--H--H--P--G--A--D--Y--P--V--D--G--L--P--D--L--G--H--A--Q--D--L--M--D--G--L

------------------------------------------------>
--P--P--G--D--S--N--Q--L--A--W--F--D--T--D--L--*-
GCCTCCAGGTGACAGCAATCAGCTGGCCTGGTTTGATACTGACCTGTAA
:::::::::::::::::::::::::::::::::::::::::::::::::
GCCTCCAGGTGACAGCAATCAGCTGGCCTGGTTTGATACTGACCTGTAA
--P--P--G--D--S--N--Q--L--A--W--F--D--T--D--L--*-

Pig Consensus Sequence

>BGISUST0000902758
---------------GATTTGATGGAGCTGGACATGGCTATGGAGCCAGACAGAAAAGCGGCTGTTAGTCACTGGCAGCAACAGTCTTACCTGGACTCTG
GAATCCATTCTGGTGCCACGACCACAGCTCCTTCTCTAAGTGGTAAAGGCAATCCTGAAGAAGAGGATGTGGATACCACCCAAGTCCTATATGAGTGGGA
GCAGGGATTTTCTCAGTCCTTCACTCAAGAACAAGTGGCT---ATTGATGGACAGTATGCAATGACTCGCGCTCAGAGGGTACGAGCTGCTATGTTCCCT
GAGACATTAGATGAGGGCATGCAGATCCCATCTACACAGTTTGACGCTGCTCATCCCACTAATGTCCAGCGTCTGGCTGAACCATCACAGATGCTGAAAC
ATGCAGTTGTAAATTTGATTAACTATCAAGATGATGCAGAACTTGCCACACGTGCAATCCCCGAATTGACAAAATTGCTAAATGATGAAGACCAGGTAGT
GGTGAATAAGGCTGCAGTTATGGTCCATCAGCTTTCCAAAAAGGAAGCTTCCAGACATGCCATCATGCGTTCTCCTCAGATGGTGTCTGCAATTGTACGT
ACCATGCAGAATACAAATGATGTAGAAACGGCTCGCTGTACTGCTGGGACCTTGCACAATCTTTCCCATCATCGTGAGGGCTTGCTGGCCATCTTTAAAT
CTGGGGGCATTCCTGCCCTAGTGAAGATGCTT---TCACCAGTGGATTCTGTATTGTTTTATGCCATTACAACTCTTCACAACCTTTTATTGCATCAGGA
AGGAGCTAAAATGGCAGTGCGTTTAGCTGGCGGGCTGCAGAAAATGGTTGCCTTGCTCAACAAAACAAATGTTAAATTCTTGGCTATTACAACAGACTGC
CTTCAGATTTTAGCTTACGGCAATCAAGAAAGCAAGCTGATCATTCTGGCTAGTGGTGGACCTCAAGCTTTAGTgaGTATAATGAGGACCTACACTTATG
AGAAACTACTGTGGACCACAAGCCGAGTACTGAAGGTGCTCTCTGTCTGCTCTAGTAATAAGCCAGCTATTGTAGAAGCT---GGAATGCAAGCTTTAGG
ACTTCATCTGACAGATCCAAGTCAACGTCTTGTTCAGAACTGTCTTTGGACTCTTAGGAATCTTTCAGATGCTGCAACTAAACAGGAAGGGATGGAAGGT
CTTCTTGGGACCCTTGTTCAGCTTCTGGGCTCGGATGATATAAATGTGGTTACCTGTGCAGCTGGAATTCTTTCTAATCTCACTTGCAATAATTATAAAA
ACAAGATGATGGTGTGCCAAGTGGGTGGTATAGAGGCTCTTGTGCGTACTGTCCTTCGTGCTGGTGACAGGGAGGACATCACTGAACCTGCCATCTGTGC
TCTCCGTCATCTGACCAGCCGACACCAGGAAGCTGAGATGGCCCAGAATGCTGTTCGCCTTCACTACGGACTACCAGTTGTGGTTAAACTCCTACATCCA
CCATCCCATTGGCCTCTCATCAAGGCTACCGTTGGATTGATTCGAAATCTTGCCCTTTGTCCAGCAAATCATGCACCTTTGCGAGAGCAGGGTGCCATTC
CACGACTAGTTCAGTTGCTGGTTCGTGCTCATCAGGATACCCAGCGCCGTACGTCCATGGGTGGAACACAGCAACAGTTTGTGGAGGGGGTCCGCATGGA
AGAAATAGTTGAAGGTTGTACTGGAGCCCTTCATATCCTAGCTCGGGATGTTCACAACCGAATTGTTATCAGAGGACTAAATACCATTCCATTGTTTGTG
CAGCTGCTTTATTCTCCCATCGAAAATATCCAAAGAGTAGCTGCAGGGGTCCTCTGTGAACTTGCTCAGGACAAGGAGGCTGCAGAAGCTATTGAAGCTG
AGGGAGCCACAGCACCTCTGACAGAATTACTCCACTCTAGGAATGAAGGTGTG---ACATACGCAGCTGCTGTTTTGTTCCGAATGTCTGAGGACAAGCC
CCAGGATTATAAGAAACGGCTTTCGGTTGAGCTGACCAGTTCTCTTTTCAGAACAGAGCCAATGGCTTGGAATGAGACTGCTGATCTTGGACTTGATATT
GGTGCCCAGGGAGAACCCCTTGGATATCGCCAGGAT---CCCAGCTATCGTTCTTTTCACTCTGGTGGATACGGCCAGGATGCCTTGGGTATGGACCCCA
TGATGGAGCATGAGATGGGTGGCCACCACCCCGGTGCTGACTATCCAGTTGATGGGCTGCCAGATCTGGGGCATGCCCAGGACCTCATGGATGGGCTGCC
TCCAGGTGACAGCAATCAGCTGGCCTGGTTTGATACTGACCTGTAA


>BGISUSP0000902758
-----DLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTTQVLYEWEQGFSQSFTQEQVA-IDGQYAMTRAQRVRAAMFP
ETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVR
TMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKML-SPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVSIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA-GMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEG
LLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHP
PSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGV-TYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDI
GAQGEPLGYRQD-PSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL*