Sequences
EST Library Info
cmu2Rhinal mucous membrane - RNA from China
dbla2Unavailable
ecc4Foetus 50 days, cortex cerebri
eep2Foetus 50 days, epidermis
fce2Foetus 100 days, cerebellum
pgl2Pituitary gland
pigcb2Unavailable
sag2Salivary gland
sme1M. Semimembranosus
spl1Spleen
ssp5M. Supraspinatus
Clusters
Oligos
SNPs

Gene ID ENSG00000080503 (click for geneview)
Transcript ID ENST00000349721(link to ensembl)
Symbol SMARCA2
Localtion Chromosome:9:2005342:2183624:1 band: 9p24.3
Description Possible global transcription activator SNF2L2 (SNF2-alpha) (SWI/SNF related matrix associated actin dependent regulator of chromatin subfamily A member 2). [Source:Uniprot/SWISSPROT;Acc:P51531]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--T--P--T--D--P--G--A--M--P--H--P--G--P--S--P--G--P--G--P--S--P--G--P--I--L--G--P--S--P--G--P--
ATGTCCACGCCCACAGACCCTGGTGCGATGCCCCACCCAGGGCCTTCGCCGGGGCCTGGGCCTTCCCCTGGGCCAATTCTTGGGCCTAGTCCAGGACCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
G--P--S--P--G--S--V--H--S--M--M--G--P--S--P--G--P--P--S--V--S--H--P--M--P--T--M--G--S--T--D--F--P--Q
GACCATCCCCAGGTTCCGTCCACAGCATGATGGGGCCAAGTCCTGGACCTCCAAGTGTCTCCCATCCTATGCCGACGATGGGGTCCACAGACTTCCCACA
                 ::::::::.:::::::: : :::::::::.:::::.::::: :: :::::::::::::::::::::::..: :::::::::::
-----------------GTCCACAGTATGATGGGCCAAAGTCCTGGGCCTCCGAGTGTGTCACATCCTATGCCGACGATGGGGTCTGCTGACTTCCCACA
------------------V--H--S--M--M--G--Q--S--P--G--P--P--S--V--S--H--P--M--P--T--M--G--S--A--D--F--P--Q

------------------------><--------------------------------------------------------------------------
--E--G--M--H--Q--M--H--K--P--I--D--G--I--H--D--K--G-----I--V--E--D--I--H--C--G--S--M--K--G--T--G--M-
GGAAGGCATGCATCAAATGCATAAGCCCATCGATGGTATACATGACAAGGGG---ATTGTAGAAGACATCCATTGTGGATCCATGAAGGGCACTGGTATG
:::::::::::::::::::::::::::::: ::::::::.::::::::.:::   .::::.:::::.::::::::::::::::::::::::::.. .:::
GGAAGGCATGCATCAAATGCATAAGCCCATGGATGGTATGCATGACAAAGGGG--GTTGTGGAAGATATCCATTGTGGATCCATGAAGGGCACCACCATG
--E--G--M--H--Q--M--H--K--P--M--D--G--M--H--D--K--G--\--V--V--E--D--I--H--C--G--S--M--K--G--T--T--M-

---------------------------------------------------------><-----------------------------------------
-R--P--P--H--P--G--M--G--P--P--Q--S--P--M--D--Q--H--S--Q--G--Y--M--S--P--H--P--S--P--L--G--A--P--E--
CGACCACCTCACCCAGGCATGGGCCCTCCCCAGAGTCCAATGGATCAACACAGCCAAGGTTATATGTCACCACACCCATCTCCATTAGGAGCCCCAGAGC
::::::::::::::.:: ::::::::::::::::::::.:::::::::::.::::::   ::.:::::.::::::::::::::.::.:::::::::::::
CGACCACCTCACCCGGGAATGGGCCCTCCCCAGAGTCCGATGGATCAACATAGCCAA---TACATGTCGCCACACCCATCTCCGTTGGGAGCCCCAGAGC
-R--P--P--H--P--G--M--G--P--P--Q--S--P--M--D--Q--H--S--Q-----Y--M--S--P--H--P--S--P--L--G--A--P--E--

----------------------------------------------------------------------------------------------------
H--V--S--S--P--M--S--G--G--G--P--T--P--P--Q--M--P--P--S--Q--P--G--A--L--I--P--G--D--P--Q--A--M--S--Q
ACGTCTCCAGCCCTATGTCTGGAGGAGGCCCAACTCCACCTCAGATGCCACCAAGCCAGCCGGGGGCCCTCATCCCAGGTGATCCGCAGGCCATGAGCCA
::::.:::::::::::.:: ::::: :::::.::.::::: :::::::::::.::::::::::: .:.::::::::.::.::.:::::::: ::::::::
ACGTTTCCAGCCCTATATCGGGAGGCGGCCCGACCCCACCACAGATGCCACCGAGCCAGCCGGGCACTCTCATCCCGGGCGACCCGCAGGCAATGAGCCA
H--V--S--S--P--I--S--G--G--G--P--T--P--P--Q--M--P--P--S--Q--P--G--T--L--I--P--G--D--P--Q--A--M--S--Q

----------------------------------------------------------------------------------------------------
--P--N--R--G--P--S--P--F--S--P--V--Q--L--H--Q--L--R--A--Q--I--L--A--Y--K--M--L--A--R--G--Q--P--L--P-
GCCCAACAGAGGTCCCTCACCTTTCAGTCCTGTCCAGCTGCATCAGCTTCGAGCTCAGATTTTAGCTTATAAAATGCTGGCCCGAGGCCAGCCCCTCCCC
:.::::::::::::::::.:::::::::::.:::::::::::::::::  :::::::::::::::::::.::::::::::::::.:::::::::::::: 
GTCCAACAGAGGTCCCTCGCCTTTCAGTCCCGTCCAGCTGCATCAGCTGAGAGCTCAGATTTTAGCTTACAAAATGCTGGCCCGGGGCCAGCCCCTCCCA
--S--N--R--G--P--S--P--F--S--P--V--Q--L--H--Q--L--R--A--Q--I--L--A--Y--K--M--L--A--R--G--Q--P--L--P-

----------------------------------------------------------------------------------------------------
-E--T--L--Q--L--A--V--Q--G--K--R--T--L--P--G--L--Q--Q--Q--Q--Q--Q--Q--Q--Q--Q--Q--Q--Q--Q--Q--Q--Q--
GAAACGCTGCAGCTTGCAGTCCAGGGGAAAAGGACGTTGCCTGGCTTGCAGCAACAACAGCAGCAGCAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGC
:::::.::::::::::::::::::::::::::::::::::::::: ::::::::::.:::: .: .: .:::.  ::::  :::: ::::: ::::::::
GAAACACTGCAGCTTGCAGTCCAGGGGAAAAGGACGTTGCCTGGCATGCAGCAACAGCAGCCACCACCGCAGTCCCAGCCTCAGCCGCAGCCGCAGCAGC
-E--T--L--Q--L--A--V--Q--G--K--R--T--L--P--G--M--Q--Q--Q--Q--P--P--P--Q--S--Q--P--Q--P--Q--P--Q--Q--

--------------------------------------------------------------------------------------------><------
Q--Q--Q--Q--Q--Q--P--Q--Q--Q--P--P--Q--P--Q--T--Q--Q--Q--Q--Q--P--A--L--V--N--Y--N--R--P--S--G--P--G
AGCAGCAGCAACAGCAGCCGCAGCAGCAGCCGCCGCAACCACAGACGCAGCAACAACAGCAGCCGGCCCTTGTTAACTACAACAGACCATCTGGCCCGGG
 :::.:::::.:::                                                                                 :::::
CGCAACAGCAGCAG---------------------------------------------------------------------------------CCGGG
P--Q--Q--Q--Q-----------------------------------------------------------------------------------P--G

----------------------------------------------------------------------------------------------------
--P--E--L--S--G--P--S--T--P--Q--K--L--P--V--P--A--P--G--G--R--P--S--P--A--P--P--A--A--A--Q--P--P--A-
GCCGGAGCTGAGCGGCCCGAGCACCCCGCAGAAGCTGCCGGTGCCCGCGCCCGGCGGCCGGCCCTCGCCCGCGCCCCCCGCAGCCGCGCAGCCGCCCGCG
:::.::::::.::::::::::. :::::::::::::::: :::::.::::::.:::::::::::::::::::.::::::::::: ::.: .:::::.:::
GCCAGAGCTGGGCGGCCCGAGTCCCCCGCAGAAGCTGCCTGTGCCTGCGCCCAGCGGCCGGCCCTCGCCCGCACCCCCCGCAGCAGCACCACCGCCTGCG
--P--E--L--G--G--P--S--P--P--Q--K--L--P--V--P--A--P--S--G--R--P--S--P--A--P--P--A--A--A--P--P--P--A-

----------------------------------------------------------------------------------------------------
-A--A--V--P--G--P--S--V--P--Q--P--A--P--G--Q--P--S--P--V--L--Q--L--Q--Q--K--Q--S--R--I--S--P--I--Q--
GCCGCAGTGCCCGGGCCCTCAGTGCCGCAGCCGGCCCCGGGGCAGCCCTCGCCCGTCCTCCAGCTGCAGCAGAAGCAGAGCCGCATCAGCCCCATCCAGA
:::::::::::.:::::::: ::::::::::: :::::.:::::::::::.:::.:::: ::::::::::::::::::::::: ::::::::..::::::
GCCGCAGTGCCTGGGCCCTCCGTGCCGCAGCCCGCCCCAGGGCAGCCCTCACCCATCCTGCAGCTGCAGCAGAAGCAGAGCCGGATCAGCCCTGTCCAGA
-A--A--V--P--G--P--S--V--P--Q--P--A--P--G--Q--P--S--P--I--L--Q--L--Q--Q--K--Q--S--R--I--S--P--V--Q--

------------------------------------------------><--------------------------------------------------
K--P--Q--G--L--D--P--V--E--I--L--Q--E--R--E--Y--R--L--Q--A--R--I--A--H--R--I--Q--E--L--E--N--L--P--G
AACCGCAAGGCCTGGACCCCGTGGAAATTCTGCAAGAGCGGGAATACAGACTTCAGGCCCGCATAGCTCATAGGATACAAGAACTGGAAAATCTGCCTGG
:::::::::::::::::::.:::::.::::::::.::::::::.      ::::::::.::::::::.:::::::::::.::.::::::::::: :::::
AACCGCAAGGCCTGGACCCTGTGGAGATTCTGCAGGAGCGGGAG------CTTCAGGCTCGCATAGCCCATAGGATACAGGAGCTGGAAAATCTTCCTGG
K--P--Q--G--L--D--P--V--E--I--L--Q--E--R--E--------L--Q--A--R--I--A--H--R--I--Q--E--L--E--N--L--P--G

---------------------------------------------------------------------------><-----------------------
--S--L--P--P--D--L--R--T--K--A--T--V--E--L--K--A--L--R--L--L--N--F--Q--R--Q--L--R--Q--E--V--V--A--C-
CTCTTTGCCACCAGATTTAAGAACCAAAGCAACCGTGGAACTAAAAGCACTTCGGTTACTCAATTTCCAGCGTCAGCTGAGACAGGAGGTGGTGGCCTGC
::::::::::::.:::::: :::::::::::::.::::::::.::::::::::::::::::::::::::.::::::::::::::::::::::::::::::
CTCTTTGCCACCGGATTTACGAACCAAAGCAACTGTGGAACTGAAAGCACTTCGGTTACTCAATTTCCAACGTCAGCTGAGACAGGAGGTGGTGGCCTGC
--S--L--P--P--D--L--R--T--K--A--T--V--E--L--K--A--L--R--L--L--N--F--Q--R--Q--L--R--Q--E--V--V--A--C-

----------------------------------------------------------------------------------------------------
-M--R--R--D--T--T--L--E--T--A--L--N--S--K--A--Y--K--R--S--K--R--Q--T--L--R--E--A--R--M--T--E--K--L--
ATGCGCAGGGACACGACCCTGGAGACGGCTCTCAACTCCAAAGCATACAAACGGAGCAAGCGCCAGACTCTGAGAGAAGCTCGCATGACCGAGAAGCTGG
:::::  :::::::.::::: ::::::::.:::::::::::.::::::::.:::::::::::::::::.::: :.:::::.:::::::: ::.:::::::
ATGCGGCGGGACACAACCCTCGAGACGGCCCTCAACTCCAAGGCATACAAGCGGAGCAAGCGCCAGACCCTGCGGGAAGCCCGCATGACAGAAAAGCTGG
-M--R--R--D--T--T--L--E--T--A--L--N--S--K--A--Y--K--R--S--K--R--Q--T--L--R--E--A--R--M--T--E--K--L--

-------------------------------------------------><-------------------------------------------------
E--K--Q--Q--K--I--E--Q--E--R--K--R--R--Q--K--H--Q--E--Y--L--N--S--I--L--Q--H--A--K--D--F--K--E--Y--H
AGAAGCAGCAGAAGATTGAGCAGGAGAGGAAACGCCGTCAGAAACACCAGGAATACCTGAACAGTATTTTGCAACATGCAAAAGATTTTAAGGAATATCA
::::::::::::::::.::::::::::::::.::.:: :::::.::::::::::::::::::::::::::::::::::::::::::::::::::.:::::
AGAAGCAGCAGAAGATCGAGCAGGAGAGGAAGCGTCGGCAGAAGCACCAGGAATACCTGAACAGTATTTTGCAACATGCAAAAGATTTTAAGGAGTATCA
E--K--Q--Q--K--I--E--Q--E--R--K--R--R--Q--K--H--Q--E--Y--L--N--S--I--L--Q--H--A--K--D--F--K--E--Y--H

----------------------------------------------------------------------------------------------------
--R--S--V--A--G--K--I--Q--K--L--S--K--A--V--A--T--W--H--A--N--T--E--R--E--Q--K--K--E--T--E--R--I--E-
TCGGTCTGTGGCCGGAAAGATCCAGAAGCTCTCCAAAGCAGTGGCAACTTGGCATGCCAACACTGAAAGAGAGCAGAAGAAGGAGACAGAGCGGATTGAA
:::.::::::                                                                                          
TCGATCTGTG------------------------------------------------------------------------------------------
--R--S--V-------------------------------------------------------------------------------------------

-----------------------><---------------------------------------------------------------------------
-K--E--R--M--R--R--L--M--A--E--D--E--E--G--Y--R--K--L--I--D--Q--K--K--D--R--R--L--A--Y--L--L--Q--Q--
AAGGAGAGAATGCGGCGACTGATGGCTGAAGATGAGGAGGGTTATAGAAAACTGATTGATCAAAAGAAAGACAGGCGTTTAGCTTACCTTTTGCAGCAGA
                        :::::::::::.::.::.::.::::::::::::::::::::::::::.::::::::::::::::::::::::::::
------------------------GCTGAAGATGAAGAAGGCTACAGAAAACTGATTGATCAAAAGAAAGATAGGCGTTTAGCTTACCTTTTGCAGCAGA
-------------------------A--E--D--E--E--G--Y--R--K--L--I--D--Q--K--K--D--R--R--L--A--Y--L--L--Q--Q--

----------------------------------------------------------------------------------------------><----
T--D--E--Y--V--A--N--L--T--N--L--V--W--E--H--K--Q--A--Q--A--A--K--E--K--K--K--R--R--R--R--K--K--K--A
CCGATGAGTATGTAGCCAATCTGACCAATCTGGTTTGGGAGCACAAGCAAGCCCAGGCAGCCAAAGAGAAGAAGAAGAGGAGGAGGAGGAAGAAGAAGGC
:.:::::::::::.:::::..:::::::.::::::::::::                                                           
CTGATGAGTATGTGGCCAACTTGACCAACCTGGTTTGGGAG-----------------------------------------------------------
T--D--E--Y--V--A--N--L--T--N--L--V--W--E------------------------------------------------------------

------------------------------------------------><--------------------------------------------------
--E--E--N--A--E--G--G--E--S--A--L--G--P--D--G--E--P--I--D--E--S--S--Q--M--S--D--L--P--V--K--V--T--H-
TGAGGAGAATGCAGAGGGTGGGGAGTCTGCCCTGGGACCGGATGGAGAGCCCATAGATGAGAGCAGCCAGATGAGTGACCTCCCTGTCAAAGTGACTCAC
                                                 :: ::::::::::::::.:::::::::::::: ::::::::::::::.:::
-------------------------------------------------CCAATAGATGAGAGCAGTCAGATGAGTGACCTGCCTGTCAAAGTGACCCAC
--------------------------------------------------P--I--D--E--S--S--Q--M--S--D--L--P--V--K--V--T--H-

-------------------------------------------------------------------------------><-------------------
-T--E--T--G--K--V--L--F--G--P--E--A--P--K--A--S--Q--L--D--A--W--L--E--M--N--P--G--Y--E--V--A--P--R--
ACAGAAACCGGCAAGGTTCTGTTCGGACCAGAAGCACCCAAAGCAAGTCAGCTGGACGCCTGGCTGGAAATGAATCCTGGTTATGAAGTTGCCCCTAGAT
::::::::.::::::::.:::::.:: :: ::::::::::::::::::::::::::.::::::.::::::::::::::   ::.::::::::::::::::
ACAGAAACTGGCAAGGTCCTGTTTGGCCCCGAAGCACCCAAAGCAAGTCAGCTGGATGCCTGGTTGGAAATGAATCCT---TACGAAGTTGCCCCTAGAT
-T--E--T--G--K--V--L--F--G--P--E--A--P--K--A--S--Q--L--D--A--W--L--E--M--N--P-----Y--E--V--A--P--R--

-------------------------------------><-------------------------------------------------------------
S--D--S--E--E--S--D--S--D--Y--E--E--E--D--E--E--E--E--S--S--R--Q--E--T--E--E--K--I--L--L--D--P--N--S
CTGACAGTGAAGAGAGTGATTCTGATTATGAGGAAGAGGATGAGGAAGAAGAGTCCAGTAGGCAGGAAACCGAAGAGAAAATACTCCTGGATCCAAATAG
: ::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::.::::::::::::::..:::::::.::.::
CGGACAGTGAAGAGAGTGATTCTGATTATGAGGAGGAGGATGAGGAAGAAGAGTCCAGTAGGCAGGAAACTGAAGAGAAAATACTTTTGGATCCGAACAG
S--D--S--E--E--S--D--S--D--Y--E--E--E--D--E--E--E--E--S--S--R--Q--E--T--E--E--K--I--L--L--D--P--N--S

--------------------------------------><------------------------------------------------------------
--E--E--V--S--E--K--D--A--K--Q--I--I--E--T--A--K--Q--D--V--D--D--E--Y--S--M--Q--Y--S--A--R--G--S--Q-
CGAAGAAGTTTCTGAGAAGGATGCTAAGCAGATCATTGAGACAGCTAAGCAAGACGTGGATGATGAATACAGCATGCAGTACAGTGCCAGGGGCTCCCAG
.:::::.::::::::::::::::::::::::::::::   :::::::::::.::.:::::.:::::.:::::::::::::::::::::::::::::::::
TGAAGAGGTTTCTGAGAAGGATGCTAAGCAGATCATT---ACAGCTAAGCAGGATGTGGACGATGAGTACAGCATGCAGTACAGTGCCAGGGGCTCCCAG
--E--E--V--S--E--K--D--A--K--Q--I--I-----T--A--K--Q--D--V--D--D--E--Y--S--M--Q--Y--S--A--R--G--S--Q-

--------------------------------------------------------------------------------------><------------
-S--Y--Y--T--V--A--H--A--I--S--E--R--V--E--K--Q--S--A--L--L--I--N--G--T--L--K--H--Y--Q--L--Q--G--L--
TCCTACTACACCGTGGCTCATGCCATCTCGGAGAGGGTGGAGAAACAGTCTGCCCTCCTAATTAATGGGACCCTAAAGCATTACCAGCTCCAGGGCCTGG
::::::::::: :::::.::.::::::::.::::::::.:::::.:::::.:::::::: ::::::::::::::.::::::::.::::::::::::::::
TCCTACTACACGGTGGCCCACGCCATCTCAGAGAGGGTAGAGAAGCAGTCCGCCCTCCTCATTAATGGGACCCTGAAGCATTATCAGCTCCAGGGCCTGG
-S--Y--Y--T--V--A--H--A--I--S--E--R--V--E--K--Q--S--A--L--L--I--N--G--T--L--K--H--Y--Q--L--Q--G--L--

----------------------------------------------------------------------------------------------------
E--W--M--V--S--L--Y--N--N--N--L--N--G--I--L--A--D--E--M--G--L--G--K--T--I--Q--T--I--A--L--I--T--Y--L
AATGGATGGTTTCCCTGTATAATAACAACTTGAACGGAATCTTAGCCGATGAAATGGGGCTTGGAAAGACCATACAGACCATTGCACTCATCACTTATCT
:::::::::::::.::::::::::::::.:::::::::::::::::.:::::::::::::: ::::::::::::::::::::::::::::::::::::::
AATGGATGGTTTCTCTGTATAATAACAATTTGAACGGAATCTTAGCTGATGAAATGGGGCTGGGAAAGACCATACAGACCATTGCACTCATCACTTATCT
E--W--M--V--S--L--Y--N--N--N--L--N--G--I--L--A--D--E--M--G--L--G--K--T--I--Q--T--I--A--L--I--T--Y--L

--------------------------------------------------><------------------------------------------------
--M--E--H--K--R--L--N--G--P--Y--L--I--I--V--P--L--S--T--L--S--N--W--T--Y--E--F--D--K--W--A--P--S--V-
GATGGAGCACAAAAGACTCAATGGCCCCTATCTCATCATTGTTCCCCTTTCGACTCTATCTAACTGGACATATGAATTTGACAAATGGGCTCCTTCTGTG
:::::::::::::::::::::::::::::::::::::::::::::::::                                                   
GATGGAGCACAAAAGACTCAATGGCCCCTATCTCATCATTGTTCCCCTT---------------------------------------------------
--M--E--H--K--R--L--N--G--P--Y--L--I--I--V--P--L----------------------------------------------------

-----------------><---------------------------------------------------------------------------------
-V--K--I--S--Y--K--G--T--P--A--M--R--R--S--L--V--P--Q--L--R--S--G--K--F--N--V--L--L--T--T--Y--E--Y--
GTGAAGATTTCTTACAAGGGTACTCCTGCCATGCGTCGCTCCCTTGTCCCCCAGCTACGGAGTGGCAAATTCAATGTCCTCTTGACTACTTATGAGTATA
                  ::.::.::::::::::::::::::::::::::::::::::::::::::::.::.:::::::::.::::.:::::.::.::.:
------------------GGCACCCCTGCCATGCGTCGCTCCCTTGTCCCCCAGCTACGGAGTGGCAAGTTTAATGTCCTCCTGACCACTTACGAATACA
-------------------G--T--P--A--M--R--R--S--L--V--P--Q--L--R--S--G--K--F--N--V--L--L--T--T--Y--E--Y--

----------------------------><----------------------------------------------------------------------
I--I--K--D--K--H--I--L--A--K--I--R--W--K--Y--M--I--V--D--E--G--H--R--M--K--N--H--H--C--K--L--T--Q--V
TTATAAAAGACAAGCACATTCTTGCAAAGATTCGGTGGAAATACATGATAGTGGACGAAGGCCACCGAATGAAGAATCACCACTGCAAGCTGACTCAGGT
:::::::::::::::::::::::::::::::::::::::::::.::::::::::::::.:::::::::::::::::::::::::::::::::::::::::
TTATAAAAGACAAGCACATTCTTGCAAAGATTCGGTGGAAATATATGATAGTGGACGAGGGCCACCGAATGAAGAATCACCACTGCAAGCTGACTCAGGT
I--I--K--D--K--H--I--L--A--K--I--R--W--K--Y--M--I--V--D--E--G--H--R--M--K--N--H--H--C--K--L--T--Q--V

----------------------------------------------------------------------------------------------------
--L--N--T--H--Y--V--A--P--R--R--I--L--L--T--G--T--P--L--Q--N--K--L--P--E--L--W--A--L--L--N--F--L--L-
CTTGAACACTCACTATGTGGCCCCCAGAAGGATCCTCTTGACTGGGACCCCGCTGCAGAATAAGCTCCCTGAACTCTGGGCCCTCCTCAACTTCCTCCTC
:::::::::::::::.:::::::::::.::::::::::::::.::::::::.:::::::::::::: :: ::::::::::::::::::::::::::::::
CTTGAACACTCACTACGTGGCCCCCAGGAGGATCCTCTTGACCGGGACCCCACTGCAGAATAAGCTGCCGGAACTCTGGGCCCTCCTCAACTTCCTCCTC
--L--N--T--H--Y--V--A--P--R--R--I--L--L--T--G--T--P--L--Q--N--K--L--P--E--L--W--A--L--L--N--F--L--L-

-----------------------------------------------------------------------><---------------------------
-P--T--I--F--K--S--C--S--T--F--E--Q--W--F--N--A--P--F--A--M--T--G--E--R--V--D--L--N--E--E--E--T--I--
CCAACAATTTTTAAGAGCTGCAGCACATTTGAACAATGGTTCAATGCTCCATTTGCCATGACTGGTGAAAGGGTGGACTTAAATGAAGAAGAAACTATAT
:: ::.:::::::::::.:::::::::::::::::.:::::.::::::::::::::::::::::: ::.:::::::::::::::::::::::::::::::
CCCACGATTTTTAAGAGTTGCAGCACATTTGAACAGTGGTTTAATGCTCCATTTGCCATGACTGGAGAGAGGGTGGACTTAAATGAAGAAGAAACTATAT
-P--T--I--F--K--S--C--S--T--F--E--Q--W--F--N--A--P--F--A--M--T--G--E--R--V--D--L--N--E--E--E--T--I--

-------------------------------------------------------------------------------------><-------------
L--I--I--R--R--L--H--K--V--L--R--P--F--L--L--R--R--L--K--K--E--V--E--S--Q--L--P--E--K--V--E--Y--V--I
TGATCATCAGGCGTCTACATAAGGTGTTAAGACCATTTTTACTAAGGAGACTGAAGAAAGAAGTTGAATCCCAGCTTCCCGAAAAAGTGGAATATGTGAT
::::::::::::::::::::::::::::.::::::::::::::.::::::::::::::::::::::::::::::::::: :::::::: :::::::::::
TGATCATCAGGCGTCTACATAAGGTGTTGAGACCATTTTTACTGAGGAGACTGAAGAAAGAAGTTGAATCCCAGCTTCCAGAAAAAGTTGAATATGTGAT
L--I--I--R--R--L--H--K--V--L--R--P--F--L--L--R--R--L--K--K--E--V--E--S--Q--L--P--E--K--V--E--Y--V--I

---------------------------------------------------------------------------------------------><-----
--K--C--D--M--S--A--L--Q--K--I--L--Y--R--H--M--Q--A--K--G--I--L--L--T--D--G--S--E--K--D--K--K--G--K-
CAAGTGTGACATGTCAGCTCTGCAGAAGATTCTGTATCGCCATATGCAAGCCAAGGGGATCCTTCTCACAGATGGTTCTGAGAAAGATAAGAAGGGGAAA
:::::::::::::::::::.:::::::::::::::::::.::::::::::::::.:: :::::.::::::::::::::::::::::::::::::::::::
CAAGTGTGACATGTCAGCTTTGCAGAAGATTCTGTATCGTCATATGCAAGCCAAAGGCATCCTCCTCACAGATGGTTCTGAGAAAGATAAGAAGGGGAAA
--K--C--D--M--S--A--L--Q--K--I--L--Y--R--H--M--Q--A--K--G--I--L--L--T--D--G--S--E--K--D--K--K--G--K-

--------------------------------------------------------------------------------><------------------
-G--G--A--K--T--L--M--N--T--I--M--Q--L--R--K--I--C--N--H--P--Y--M--F--Q--H--I--E--E--S--F--A--E--H--
GGAGGTGCTAAGACACTTATGAACACTATTATGCAGTTGAGAAAAATCTGCAACCACCCATATATGTTTCAGCACATTGAGGAATCCTTTGCTGAACACC
:::::::::::::::::::::::::::::.:::::.:::::::::::::::::.::::: :::::::::::::::::::::::::::::::: :::::::
GGAGGTGCTAAGACACTTATGAACACTATCATGCAATTGAGAAAAATCTGCAATCACCCCTATATGTTTCAGCACATTGAGGAATCCTTTGCAGAACACC
-G--G--A--K--T--L--M--N--T--I--M--Q--L--R--K--I--C--N--H--P--Y--M--F--Q--H--I--E--E--S--F--A--E--H--

---------------------------><-----------------------------------------------------------------------
L--G--Y--S--N--G--V--I--N--G--A--E--L--Y--R--A--S--G--K--F--E--L--L--D--R--I--L--P--K--L--R--A--T--N
TAGGCTATTCAAATGGGGTCATCAATGGGGCTGAACTGTATCGGGCCTCAGGGAAGTTTGAGCTGCTTGATCGTATTCTGCCAAAATTGAGAGCGACTAA
:.::::::::::::::::::::::::   ::.::.:::::::::::::::::.:::::::::::.:::::::::::::::::::::::::::::::::::
TGGGCTATTCAAATGGGGTCATCAAT---GCCGAGCTGTATCGGGCCTCAGGAAAGTTTGAGCTACTTGATCGTATTCTGCCAAAATTGAGAGCGACTAA
L--G--Y--S--N--G--V--I--N-----A--E--L--Y--R--A--S--G--K--F--E--L--L--D--R--I--L--P--K--L--R--A--T--N

----------------------------------------------------------------------------------------------><----
--H--R--V--L--L--F--C--Q--M--T--S--L--M--T--I--M--E--D--Y--F--A--F--R--N--F--L--Y--L--R--L--D--G--T-
TCACCGAGTGCTGCTTTTCTGCCAGATGACATCTCTCATGACCATCATGGAGGATTATTTTGCTTTTCGGAACTTCCTTTACCTACGCCTTGATGGCACC
:::::: :::::::::::::::::::::::.::::::::::::::::::::::::::.::::::::::::::::::::::::::.:::::::::   :::
TCACCGCGTGCTGCTTTTCTGCCAGATGACGTCTCTCATGACCATCATGGAGGATTACTTTGCTTTTCGGAACTTCCTTTACCTGCGCCTTGAT---ACC
--H--R--V--L--L--F--C--Q--M--T--S--L--M--T--I--M--E--D--Y--F--A--F--R--N--F--L--Y--L--R--L--D-----T-

----------------------------------------------------------------------------------------------------
-T--K--S--E--D--R--A--A--L--L--K--K--F--N--E--P--G--S--Q--Y--F--I--F--L--L--S--T--R--A--G--G--L--G--
ACCAAGTCTGAAGATCGTGCTGCTTTGCTGAAGAAATTCAATGAACCTGGATCCCAGTATTTCATTTTCTTGCTGAGCACAAGAGCTGGTGGCCTGGGCT
:::::.::::::::::::::::::.::::::::::::::::::::::.::.::::::::::::::.::::::::::::::.:::::::: :::::::::.
ACCAAATCTGAAGATCGTGCTGCTCTGCTGAAGAAATTCAATGAACCCGGGTCCCAGTATTTCATCTTCTTGCTGAGCACGAGAGCTGGAGGCCTGGGCC
-T--K--S--E--D--R--A--A--L--L--K--K--F--N--E--P--G--S--Q--Y--F--I--F--L--L--S--T--R--A--G--G--L--G--

----------------------------------------------------------><----------------------------------------
L--N--L--Q--A--A--D--T--V--V--I--F--D--S--D--W--N--P--H--Q--D--L--Q--A--Q--D--R--A--H--R--I--G--Q--Q
TAAATCTTCAGGCAGCTGATACAGTGGTCATCTTTGACAGCGACTGGAATCCTCATCAGGATCTGCAGGCCCAAGACCGAGCTCACCGCATCGGGCAGCA
::::.::.:::::::::::::: ::::::::::::::::::::::::::::::::.:::::.:::::.:: ::.::::: :::::::::::.:: :::::
TAAACCTCCAGGCAGCTGATACTGTGGTCATCTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCACAGGACCGTGCTCACCGCATTGGCCAGCA
L--N--L--Q--A--A--D--T--V--V--I--F--D--S--D--W--N--P--H--Q--D--L--Q--A--Q--D--R--A--H--R--I--G--Q--Q

----------------------------------------------------------------------------------------------------
--N--E--V--R--V--L--R--L--C--T--V--N--S--V--E--E--K--I--L--A--A--A--K--Y--K--L--N--V--D--Q--K--V--I-
GAACGAGGTCCGGGTACTGAGGCTCTGTACCGTGAACAGCGTGGAGGAAAAGATCCTCGCGGCCGCAAAATACAAGCTGAACGTGGATCAGAAAGTGATC
:::::::::::: ::::::::.::::::::::::::::::::::::::::::::.:::::.::::: ::.:::::::::::.::::::::::::::::::
GAACGAGGTCCGCGTACTGAGACTCTGTACCGTGAACAGCGTGGAGGAAAAGATTCTCGCAGCCGCCAAGTACAAGCTGAATGTGGATCAGAAAGTGATC
--N--E--V--R--V--L--R--L--C--T--V--N--S--V--E--E--K--I--L--A--A--A--K--Y--K--L--N--V--D--Q--K--V--I-

--------------------------------------------------------------------------------------><------------
-Q--A--G--M--F--D--Q--K--S--S--S--H--E--R--R--A--F--L--Q--A--I--L--E--H--E--E--E--N--E--E--E--D--E--
CAGGCGGGCATGTTTGACCAAAAGTCTTCAAGCCACGAGCGGAGGGCATTCCTGCAGGCCATCTTGGAGCATGAGGAGGAAAATGAGGAAGAAGATGAAG
:::::::::::::::::.:::::::::::::::::.:::::::::::::::::::::::::: .::::::::::.:::::::::::::::::::::::::
CAGGCGGGCATGTTTGATCAAAAGTCTTCAAGCCATGAGCGGAGGGCATTCCTGCAGGCCATACTGGAGCATGAAGAGGAAAATGAGGAAGAAGATGAAG
-Q--A--G--M--F--D--Q--K--S--S--S--H--E--R--R--A--F--L--Q--A--I--L--E--H--E--E--E--N--E--E--E--D--E--

----------------------------------------------------------------><----------------------------------
V--P--D--D--E--T--L--N--Q--M--I--A--R--R--E--E--E--F--D--L--F--M--R--M--D--M--D--R--R--R--E--D--A--R
TACCGGACGATGAGACTCTGAACCAAATGATTGCTCGACGAGAAGAAGAATTTGACCTTTTTATGCGGATGGACATGGACCGGCGGAGGGAAGATGCCCG
:.:: ::::::::::::::::::::::::::::::::::::::.::.::::::::.::::::::::: :::::::::::::::::::::::.::::::::
TGCCCGACGATGAGACTCTGAACCAAATGATTGCTCGACGAGAGGAGGAATTTGATCTTTTTATGCGCATGGACATGGACCGGCGGAGGGAGGATGCCCG
V--P--D--D--E--T--L--N--Q--M--I--A--R--R--E--E--E--F--D--L--F--M--R--M--D--M--D--R--R--R--E--D--A--R

----------------------------------------------------------------------------------------------------
--N--P--K--R--K--P--R--L--M--E--E--D--E--L--P--S--W--I--I--K--D--D--A--E--V--E--R--L--T--C--E--E--E-
GAACCCGAAACGGAAGCCCCGTTTAATGGAGGAGGATGAGCTGCCCTCCTGGATCATTAAGGATGACGCTGAAGTAGAAAGGCTCACCTGTGAAGAAGAG
:::.:::::::: ::::::::.::.::::::::::::::::::::.::::::::.:::::::::::.:::::.::.:::::::: :: ::::::::::::
GAATCCGAAACGCAAGCCCCGCTTGATGGAGGAGGATGAGCTGCCTTCCTGGATTATTAAGGATGATGCTGAGGTGGAAAGGCTGACATGTGAAGAAGAG
--N--P--K--R--K--P--R--L--M--E--E--D--E--L--P--S--W--I--I--K--D--D--A--E--V--E--R--L--T--C--E--E--E-

-----------------------------------------------------------------------------------><---------------
-E--E--K--I--F--G--R--G--S--R--Q--R--R--D--V--D--Y--S--D--A--L--T--E--K--Q--W--L--R--A--I--E--D--G--
GAGGAGAAAATATTTGGGAGGGGGTCCCGCCAGCGCCGTGACGTGGACTACAGTGACGCCCTCACGGAGAAGCAGTGGCTAAGGGCCATCGAAGACGGCA
::::::::::::::.:::::::: ::.::::::::.:: ::.:::::::::::::::::::::::::::::.::::::::.::::::::.::::::::::
GAGGAGAAAATATTCGGGAGGGGTTCTCGCCAGCGTCGGGATGTGGACTACAGTGACGCCCTCACGGAGAAACAGTGGCTGAGGGCCATTGAAGACGGCA
-E--E--K--I--F--G--R--G--S--R--Q--R--R--D--V--D--Y--S--D--A--L--T--E--K--Q--W--L--R--A--I--E--D--G--

----------------------------------------------------------------------------------------------------
N--L--E--E--M--E--E--E--V--R--L--K--K--R--K--R--R--R--N--V--D--K--D--P--A--K--E--D--V--E--K--A--K--K
ATTTGGAGGAAATGGAAGAGGAAGTACGGCTTAAGAAGCGAAAAAGACGAAGAAATGTGGATAAAGATCCTGCAAAAGAAGATGTGGAAAAAGCTAAGAA
:::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::::::.::.:::::
ATTTGGAAGAAATGGAAGAGGAAGTACGGCTTAAGAAGCGAAAAAGACGAAGAAATGTGGATAAAGATCCGGCAAAAGAAGATGTGGAAAAGGCCAAGAA
N--L--E--E--M--E--E--E--V--R--L--K--K--R--K--R--R--R--N--V--D--K--D--P--A--K--E--D--V--E--K--A--K--K

----------------------------------------------------------------------------------------------------
--R--R--G--R--P--P--A--E--K--L--S--P--N--P--P--K--L--T--K--Q--M--N--A--I--I--D--T--V--I--N--Y--K--D-
GAGAAGAGGCCGCCCTCCCGCTGAGAAACTGTCACCAAATCCCCCCAAACTGACAAAGCAGATGAACGCTATCATCGATACTGTGATAAACTACAAAGAT
:::.:::::.:::::.:: :::::::::::.::::::::::::::.::.::::: :::::.::::::::::::::.::::::::::: :::::::::   
GAGGAGAGGTCGCCCCCCAGCTGAGAAACTATCACCAAATCCCCCTAAGCTGACCAAGCAAATGAACGCTATCATTGATACTGTGATCAACTACAAA---
--R--R--G--R--P--P--A--E--K--L--S--P--N--P--P--K--L--T--K--Q--M--N--A--I--I--D--T--V--I--N--Y--K----

-><----------------------------------------------------><-------------------------------------------
-R--C--N--V--E--K--V--P--S--N--S--Q--L--E--I--E--G--N--S--S--G--R--Q--L--S--E--V--F--I--Q--L--P--S--
AGGTGTAACGTGGAGAAGGTGCCCAGTAATTCTCAGTTGGAAATAGAAGGAAACAGTTCAGGGCGACAGCTCAGTGAAGTCTTCATTCAGTTACCTTCAA
   :::::::::::::::::::::::::::::::::::::::::::::::::::   :::::::::::::::::::::::::::::::::::::::::::
---TGTAACGTGGAGAAGGTGCCCAGTAATTCTCAGTTGGAAATAGAAGGAAAC---TCAGGGCGACAGCTCAGTGAAGTCTTCATTCAGTTACCTTCAA
----C--N--V--E--K--V--P--S--N--S--Q--L--E--I--E--G--N-----S--G--R--Q--L--S--E--V--F--I--Q--L--P--S--

-------------------------------------------------------------><-------------------------------------
R--K--E--L--P--E--Y--Y--E--L--I--R--K--P--V--D--F--K--K--I--K--E--R--I--R--N--H--K--Y--R--S--L--G--D
GGAAAGAATTACCAGAATACTATGAATTAATTAGGAAGCCAGTGGATTTCAAAAAAATAAAGGAAAGGATTCGTAATCATAAGTACCGGAGCCTAGGCGA
:.:::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::.::::::::.:::::::::::.:::::.::.::
GAAAAGAATTACCAGAATACTATGAATTAATTAGGAAACCAGTGGATTTCAAAAAAATAAAGGAAAGAATTCGTAACCATAAGTACCGAAGCCTGGGTGA
R--K--E--L--P--E--Y--Y--E--L--I--R--K--P--V--D--F--K--K--I--K--E--R--I--R--N--H--K--Y--R--S--L--G--D

---------------------------------------------------------------><-----------------------------------
--L--E--K--D--V--M--L--L--C--H--N--A--Q--T--F--N--L--E--G--S--Q--I--Y--E--D--S--I--V--L--Q--S--V--F-
CCTGGAGAAGGATGTCATGCTTCTCTGTCACAACGCTCAGACGTTCAACCTGGAGGGATCCCAGATCTATGAAGACTCCATCGTCTTACAGTCAGTGTTT
:::::::::.::.::::::::::::::::::::.:::::::::::::::.:::::::::::::::::::::::::::::::::: .::::::::::::::
CCTGGAGAAAGACGTCATGCTTCTCTGTCACAATGCTCAGACGTTCAACTTGGAGGGATCCCAGATCTATGAAGACTCCATCGTACTACAGTCAGTGTTT
--L--E--K--D--V--M--L--L--C--H--N--A--Q--T--F--N--L--E--G--S--Q--I--Y--E--D--S--I--V--L--Q--S--V--F-

--------------------------------------------------------------------------------------------------->
-K--S--A--R--Q--K--I--A--K--E--E--E--S--E--D--E--S--N--E--E--E--E--E--E--D--E--E--E--S--E--S--E--A--
AAGAGTGCCCGGCAGAAAATTGCCAAAGAGGAAGAGAGTGAGGATGAAAGCAATGAAGAGGAGGAAGAGGAAGATGAAGAAGAGTCAGAGTCCGAGGCAA
::::::::.::::::::::::::::: :::::::::::.:::::.:::::::::::::::::.:::::::::::::::::.::::::::::: :::   :
AAGAGTGCTCGGCAGAAAATTGCCAA-GAGGAAGAGAGCGAGGACGAAAGCAATGAAGAGGAAGAAGAGGAAGATGAAGAGGAGTCAGAGTCAGAG---A
-K--S--A--R--Q--K--I--A--K--E--E--E--S--E--D--E--S--N--E--E--E--E--E--E--D--E--E--E--S--E--S--E-----

<---------------------------------------------------------------------------------------------------
K--S--V--K--V--K--I--K--L--N--K--K--D--D--K--G--R--D--K--G--K--G--K--K--R--P--N--R--G--K--A--K--P--V
AATCAGTCAAGGTGAAAATTAAGCTCAATAAAAAAGATGACAAAGGCCGGGACAAAGGGAAAGGCAAGAAAAGGCCAAATCGAGGAAAAGCCAAACCTGT
:::: ::.:::::::::::.:::::::::::::::::::: :::::::::::::::::.:::::::::::.:::::.::::::::::::::::::::.::
AATCTGTTAAGGTGAAAATCAAGCTCAATAAAAAAGATGAGAAAGGCCGGGACAAAGGAAAAGGCAAGAAGAGGCCGAATCGAGGAAAAGCCAAACCCGT
K--S--V--K--V--K--I--K--L--N--K--K--D--E--K--G--R--D--K--G--K--G--K--K--R--P--N--R--G--K--A--K--P--V

------------------------------------------><--------------------------------
--V--S--D--F--D--S--D--E--E--Q--D--E--R--E--Q--S--E--G--S--G--T--D--D--E--*-
AGTGAGCGATTTTGACAGCGATGAGGAGCAGGATGAACGTGAACAGTCAGAAGGAAGTGGGACGGATGATGAGTGA
::::::::::::.:::::.:::::.:::::.::::::                                       
AGTGAGCGATTTCGACAGTGATGAAGAGCAAGATGAA---------------------------------------
--V--S--D--F--D--S--D--E--E--Q--D--E----------------------------------------

Pig Consensus Sequence

>BGISUST0000898432
----------------------------------------------------------------------------------------------------
-----------------GTCCACAGTATGATGGGCCAAAGTCCTGGGCCTCCGAGTGTGTCACATCCTATGCCGACGATGGGGTCTGCTGACTTCCCACA
GGAAGGCATGCATCAAATGCATAAGCCCATGGATGGTATGCATGACAAAGGggTTGTGGAAGATATCCATTGTGGATCCATGAAGGGCACCACCATGCGA
CCACCTCACCCGGGAATGGGCCCTCCCCAGAGTCCGATGGATCAACATAGCCAA---TACATGTCGCCACACCCATCTCCGTTGGGAGCCCCAGAGCACG
TTTCCAGCCCTATATCGGGAGGCGGCCCGACCCCACCACAGATGCCACCGAGCCAGCCGGGCACTCTCATCCCGGGCGACCCGCAGGCAATGAGCCAGTC
CAACAGAGGTCCCTCGCCTTTCAGTCCCGTCCAGCTGCATCAGCTGAGAGCTCAGATTTTAGCTTACAAAATGCTGGCCCGGGGCCAGCCCCTCCCAGAA
ACACTGCAGCTTGCAGTCCAGGGGAAAAGGACGTTGCCTGGCATGCAGCAACAGCAGCCACCACCGCAGTCCCAGCCTCAGCCGCAGCCGCAGCAGCCGC
AACAGCAGCAG---------------------------------------------------------------------------------CCGGGGCC
AGAGCTGGGCGGCCCGAGTCCCCCGCAGAAGCTGCCTGTGCCTGCGCCCAGCGGCCGGCCCTCGCCCGCACCCCCCGCAGCAGCACCACCGCCTGCGGCC
GCAGTGCCTGGGCCCTCCGTGCCGCAGCCCGCCCCAGGGCAGCCCTCACCCATCCTGCAGCTGCAGCAGAAGCAGAGCCGGATCAGCCCTGTCCAGAAAC
CGCAAGGCCTGGACCCTGTGGAGATTCTGCAGGAGCGGGAG------CTTCAGGCTCGCATAGCCCATAGGATACAGGAGCTGGAAAATCTTCCTGGCTC
TTTGCCACCGGATTTACGAACCAAAGCAACTGTGGAACTGAAAGCACTTCGGTTACTCAATTTCCAACGTCAGCTGAGACAGGAGGTGGTGGCCTGCATG
CGGCGGGACACAACCCTCGAGACGGCCCTCAACTCCAAGGCATACAAGCGGAGCAAGCGCCAGACCCTGCGGGAAGCCCGCATGACAGAAAAGCTGGAGA
AGCAGCAGAAGATCGAGCAGGAGAGGAAGCGTCGGCAGAAGCACCAGGAATACCTGAACAGTATTTTGCAACATGCAAAAGATTTTAAGGAGTATCATCG
ATCTGTG---------------------------------------------------------------------------------------------
---------------------GCTGAAGATGAAGAAGGCTACAGAAAACTGATTGATCAAAAGAAAGATAGGCGTTTAGCTTACCTTTTGCAGCAGACTG
ATGAGTATGTGGCCAACTTGACCAACCTGGTTTGGGAG--------------------------------------------------------------
----------------------------------------------CCAATAGATGAGAGCAGTCAGATGAGTGACCTGCCTGTCAAAGTGACCCACACA
GAAACTGGCAAGGTCCTGTTTGGCCCCGAAGCACCCAAAGCAAGTCAGCTGGATGCCTGGTTGGAAATGAATCCT---TACGAAGTTGCCCCTAGATCGG
ACAGTGAAGAGAGTGATTCTGATTATGAGGAGGAGGATGAGGAAGAAGAGTCCAGTAGGCAGGAAACTGAAGAGAAAATACTTTTGGATCCGAACAGTGA
AGAGGTTTCTGAGAAGGATGCTAAGCAGATCATT---ACAGCTAAGCAGGATGTGGACGATGAGTACAGCATGCAGTACAGTGCCAGGGGCTCCCAGTCC
TACTACACGGTGGCCCACGCCATCTCAGAGAGGGTAGAGAAGCAGTCCGCCCTCCTCATTAATGGGACCCTGAAGCATTATCAGCTCCAGGGCCTGGAAT
GGATGGTTTCTCTGTATAATAACAATTTGAACGGAATCTTAGCTGATGAAATGGGGCTGGGAAAGACCATACAGACCATTGCACTCATCACTTATCTGAT
GGAGCACAAAAGACTCAATGGCCCCTATCTCATCATTGTTCCCCTT------------------------------------------------------
---------------GGCACCCCTGCCATGCGTCGCTCCCTTGTCCCCCAGCTACGGAGTGGCAAGTTTAATGTCCTCCTGACCACTTACGAATACATTA
TAAAAGACAAGCACATTCTTGCAAAGATTCGGTGGAAATATATGATAGTGGACGAGGGCCACCGAATGAAGAATCACCACTGCAAGCTGACTCAGGTCTT
GAACACTCACTACGTGGCCCCCAGGAGGATCCTCTTGACCGGGACCCCACTGCAGAATAAGCTGCCGGAACTCTGGGCCCTCCTCAACTTCCTCCTCCCC
ACGATTTTTAAGAGTTGCAGCACATTTGAACAGTGGTTTAATGCTCCATTTGCCATGACTGGAGAGAGGGTGGACTTAAATGAAGAAGAAACTATATTGA
TCATCAGGCGTCTACATAAGGTGTTGAGACCATTTTTACTGAGGAGACTGAAGAAAGAAGTTGAATCCCAGCTTCCAGAAAAAGTTGAATATGTGATCAA
GTGTGACATGTCAGCTTTGCAGAAGATTCTGTATCGTCATATGCAAGCCAAAGGCATCCTCCTCACAGATGGTTCTGAGAAAGATAAGAAGGGGAAAGGA
GGTGCTAAGACACTTATGAACACTATCATGCAATTGAGAAAAATCTGCAATCACCCCTATATGTTTCAGCACATTGAGGAATCCTTTGCAGAACACCTGG
GCTATTCAAATGGGGTCATCAAT---GCCGAGCTGTATCGGGCCTCAGGAAAGTTTGAGCTACTTGATCGTATTCTGCCAAAATTGAGAGCGACTAATCA
CCGCGTGCTGCTTTTCTGCCAGATGACGTCTCTCATGACCATCATGGAGGATTACTTTGCTTTTCGGAACTTCCTTTACCTGCGCCTTGAT---ACCACC
AAATCTGAAGATCGTGCTGCTCTGCTGAAGAAATTCAATGAACCCGGGTCCCAGTATTTCATCTTCTTGCTGAGCACGAGAGCTGGAGGCCTGGGCCTAA
ACCTCCAGGCAGCTGATACTGTGGTCATCTTTGACAGCGACTGGAATCCTCACCAGGACCTGCAAGCACAGGACCGTGCTCACCGCATTGGCCAGCAGAA
CGAGGTCCGCGTACTGAGACTCTGTACCGTGAACAGCGTGGAGGAAAAGATTCTCGCAGCCGCCAAGTACAAGCTGAATGTGGATCAGAAAGTGATCCAG
GCGGGCATGTTTGATCAAAAGTCTTCAAGCCATGAGCGGAGGGCATTCCTGCAGGCCATACTGGAGCATGAAGAGGAAAATGAGGAAGAAGATGAAGTGC
CCGACGATGAGACTCTGAACCAAATGATTGCTCGACGAGAGGAGGAATTTGATCTTTTTATGCGCATGGACATGGACCGGCGGAGGGAGGATGCCCGGAA
TCCGAAACGCAAGCCCCGCTTGATGGAGGAGGATGAGCTGCCTTCCTGGATTATTAAGGATGATGCTGAGGTGGAAAGGCTGACATGTGAAGAAGAGGAG
GAGAAAATATTCGGGAGGGGTTCTCGCCAGCGTCGGGATGTGGACTACAGTGACGCCCTCACGGAGAAACAGTGGCTGAGGGCCATTGAAGACGGCAATT
TGGAAGAAATGGAAGAGGAAGTACGGCTTAAGAAGCGAAAAAGACGAAGAAATGTGGATAAAGATCCGGCAAAAGAAGATGTGGAAAAGGCCAAGAAGAG
GAGAGGTCGCCCCCCAGCTGAGAAACTATCACCAAATCCCCCTAAGCTGACCAAGCAAATGAACGCTATCATTGATACTGTGATCAACTACAAA------
TGTAACGTGGAGAAGGTGCCCAGTAATTCTCAGTTGGAAATAGAAGGAAAC---TCAGGGCGACAGCTCAGTGAAGTCTTCATTCAGTTACCTTCAAGAA
AAGAATTACCAGAATACTATGAATTAATTAGGAAACCAGTGGATTTCAAAAAAATAAAGGAAAGAATTCGTAACCATAAGTACCGAAGCCTGGGTGACCT
GGAGAAAGACGTCATGCTTCTCTGTCACAATGCTCAGACGTTCAACTTGGAGGGATCCCAGATCTATGAAGACTCCATCGTACTACAGTCAGTGTTTAAG
AGTGCTCGGCAGAAAATTGCcgAGGAAGAGAGCGAGGACGAAAGCAATGAAGAGGAAGAAGAGGAAGATGAAGAGGAGTCAGAGTCAGAG---AAATCTG
TTAAGGTGAAAATCAAGCTCAATAAAAAAGATGAGAAAGGCCGGGACAAAGGAAAAGGCAAGAAGAGGCCGAATCGAGGAAAAGCCAAACCCGTAGTGAG
CGATTTCGACAGTGATGAAGAGCAAGATGAA---------------------------------------


>BGISUSP0000898432
---------------------------------------VHSMMGQSPGPPSVSHPMPTMGSADFPQEGMHQMHKPMDGMHDKGVVEDIHCGSMKGTTMR
PPHPGMGPPQSPMDQHSQ-YMSPHPSPLGAPEHVSSPISGGGPTPPQMPPSQPGTLIPGDPQAMSQSNRGPSPFSPVQLHQLRAQILAYKMLARGQPLPE
TLQLAVQGKRTLPGMQQQQPPPQSQPQPQPQQPQQQQ---------------------------PGPELGGPSPPQKLPVPAPSGRPSPAPPAAAPPPAA
AVPGPSVPQPAPGQPSPILQLQQKQSRISPVQKPQGLDPVEILQERE--LQARIAHRIQELENLPGSLPPDLRTKATVELKALRLLNFQRQLRQEVVACM
RRDTTLETALNSKAYKRSKRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSV-------------------------------
-------AEDEEGYRKLIDQKKDRRLAYLLQQTDEYVANLTNLVWE------------------------------------PIDESSQMSDLPVKVTHT
ETGKVLFGPEAPKASQLDAWLEMNP-YEVAPRSDSEESDSDYEEEDEEEESSRQETEEKILLDPNSEEVSEKDAKQII-TAKQDVDDEYSMQYSARGSQS
YYTVAHAISERVEKQSALLINGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPL------------------
-----GTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLP
TIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKILYRHMQAKGILLTDGSEKDKKGKG
GAKTLMNTIMQLRKICNHPYMFQHIEESFAEHLGYSNGVIN-AELYRASGKFELLDRILPKLRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLD-TT
KSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQ
AGMFDQKSSSHERRAFLQAILEHEEENEEEDEVPDDETLNQMIARREEEFDLFMRMDMDRRREDARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEE
EKIFGRGSRQRRDVDYSDALTEKQWLRAIEDGNLEEMEEEVRLKKRKRRRNVDKDPAKEDVEKAKKRRGRPPAEKLSPNPPKLTKQMNAIIDTVINYK--
CNVEKVPSNSQLEIEGN-SGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFK
SARQKIAEEESEDESNEEEEEEDEEESESE-KSVKVKIKLNKKDEKGRDKGKGKKRPNRGKAKPVVSDFDSDEEQDE-------------