Sequences
EST Library Info
pfco1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000134115 (click for geneview)
Transcript ID ENST00000350110(link to ensembl)
Symbol CNTN6
Localtion Chromosome:3:1109629:1420278:1 band: 3p26.3
Description Contactin 6 precursor (Neural recognition molecule NB-3) (hNB-3). [Source:Uniprot/SWISSPROT;Acc:Q9UQ52]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----------------------------------------------------><--------------------------------------------
-M--R--L--L--W--K--L--V--I--L--L--P--L--I--N--S--S--A--G--D--G--L--L--S--R--P--I--F--T--Q--E--P--H--
ATGAGGTTGCTATGGAAACTGGTAATTCTGCTGCCACTCATAAACTCTTCTGCAGGTGATGGTCTTTTAAGCCGTCCTATTTTTACTCAGGAGCCACATG
::::::::::::::::::::::::::::::::::::::::::::. ::         :::::.: :::.::::.::::::::::::.:::::.::::: :
ATGAGGTTGCTATGGAAACTGGTAATTCTGCTGCCACTCATAAATACT---------GATGGCCATTTGAGCCATCCTATTTTTACCCAGGAACCACAGG
-M--R--L--L--W--K--L--V--I--L--L--P--L--I--N--T-----------D--G--H--L--S--H--P--I--F--T--Q--E--P--Q--

---------------------------------------------------------------------------------><-----------------
D--V--I--F--P--L--D--L--S--K--S--E--V--I--L--N--C--A--A--N--G--Y--P--S--P--H--Y--R--W--K--Q--N--G--T
ATGTCATTTTTCCTTTGGATTTATCAAAATCTGAGGTCATCCTGAATTGTGCTGCTAATGGTTACCCTTCGCCTCATTATAGGTGGAAGCAAAATGGCAC
::::.:::::::::::::::::.:::::::::::..::::::::::::::::::: ::::::::.::::::::.::::::   :::::::::::::::::
ATGTTATTTTTCCTTTGGATTTGTCAAAATCTGAAATCATCCTGAATTGTGCTGCAAATGGTTATCCTTCGCCCCATTAT---TGGAAGCAAAATGGCAC
D--V--I--F--P--L--D--L--S--K--S--E--I--I--L--N--C--A--A--N--G--Y--P--S--P--H--Y-----W--K--Q--N--G--T

----------------------------------------------------------------------------------------------------
--D--I--D--F--T--M--S--Y--H--Y--R--L--D--G--G--S--L--A--I--N--S--P--H--T--D--Q--D--I--G--M--Y--Q--C-
AGACATTGATTTTACTATGAGTTATCACTACAGGTTGGATGGAGGCAGTCTTGCAATCAATAGCCCCCACACAGATCAAGATATTGGCATGTACCAGTGC
:::.:::::::::::.:::::::::::::::::::::::::::::::.:.: :::::::.::::::::.::::::.:::::::::::::..:::::::::
AGATATTGATTTTACCATGAGTTATCACTACAGGTTGGATGGAGGCAATTTGGCAATCAGTAGCCCCCGCACAGACCAAGATATTGGCACATACCAGTGC
--D--I--D--F--T--M--S--Y--H--Y--R--L--D--G--G--N--L--A--I--S--S--P--R--T--D--Q--D--I--G--T--Y--Q--C-

---------------------------------------------------------><-----------------------------------------
-L--A--T--N--L--L--G--T--I--L--S--R--K--A--K--L--Q--F--A--Y--I--E--D--F--E--T--K--T--R--S--T--V--S--
CTGGCCACCAATCTTCTGGGGACAATTCTGAGTCGGAAGGCAAAGCTCCAATTTGCATATATTGAAGACTTTGAAACTAAAACAAGAAGCACAGTATCTG
:::::::::::.:.:::.::.::::::.:.:::::::::::.:::::::::::::::   :::::::::::::::::.:::::::::::::::::.::::
CTGGCCACCAACCCTCTAGGAACAATTTTAAGTCGGAAGGCGAAGCTCCAATTTGCA---ATTGAAGACTTTGAAACCAAAACAAGAAGCACAGTGTCTG
-L--A--T--N--P--L--G--T--I--L--S--R--K--A--K--L--Q--F--A-----I--E--D--F--E--T--K--T--R--S--T--V--S--

-----------------------------------------------------><---------------------------------------------
V--R--E--G--Q--G--V--V--L--L--C--G--P--P--P--H--F--G--D--L--S--Y--A--W--T--F--N--D--N--P--L--Y--V--Q
TCCGAGAAGGTCAAGGTGTGGTGCTTCTCTGTGGCCCACCGCCACATTTTGGAGATTTATCTTATGCATGGACCTTCAATGATAACCCCTTATACGTCCA
::::::::::::::::::::::::::::::::::.:::::.:::::.::::::   :::::::::::::::::.::::::::::::::::::::.:::::
TCCGAGAAGGTCAAGGTGTGGTGCTTCTCTGTGGTCCACCACCACACTTTGGA---TTATCTTATGCATGGACTTTCAATGATAACCCCTTATATGTCCA
V--R--E--G--Q--G--V--V--L--L--C--G--P--P--P--H--F--G-----L--S--Y--A--W--T--F--N--D--N--P--L--Y--V--Q

----------------------------------------------------------------------------------------------------
--E--D--N--R--R--F--V--S--Q--E--T--G--N--L--Y--I--A--K--V--E--P--S--D--V--G--N--Y--T--C--F--I--T--N-
AGAGGACAATAGGCGATTTGTATCTCAAGAGACGGGAAACTTGTACATTGCCAAAGTGGAACCATCAGATGTGGGCAACTACACTTGCTTTATAACTAAC
::::::::: ::.::::  ::::: ::::::::.:::::::::::::::::::::::::::::::::::::: :::::::::::.:::::.:::::.::.
AGAGGACAAGAGACGATG-GTATCACAAGAGACAGGAAACTTGTACATTGCCAAAGTGGAACCATCAGATGTTGGCAACTACACCTGCTTCATAACCAAT
--E--D--K--R--R--W--V--S--Q--E--T--G--N--L--Y--I--A--K--V--E--P--S--D--V--G--N--Y--T--C--F--I--T--N-

------------------------------------------------------------><--------------------------------------
-K--E--A--Q--R--S--V--Q--G--P--P--T--P--L--V--Q--R--T--D--G--V--M--G--E--Y--E--P--K--I--E--V--R--F--
AAAGAGGCCCAGAGAAGTGTTCAAGGTCCACCCACTCCATTAGTGCAGCGCACTGATGGTGTGATGGGGGAATATGAACCAAAGATTGAAGTGCGTTTTC
::.::.::::::::.::::::::::: ::.:::::::::::::: ::::::::::::   ::::::::::::::::::::::::::::::::.:::::::
AAGGAAGCCCAGAGGAGTGTTCAAGGACCGCCCACTCCATTAGTTCAGCGCACTGAT---GTGATGGGGGAATATGAACCAAAGATTGAAGTACGTTTTC
-K--E--A--Q--R--S--V--Q--G--P--P--T--P--L--V--Q--R--T--D-----V--M--G--E--Y--E--P--K--I--E--V--R--F--

---------------------------------------------------------------><-----------------------------------
P--E--T--I--Q--A--A--K--D--S--S--V--K--L--E--C--F--A--L--G--N--P--V--P--D--I--S--W--R--R--L--D--G--S
CTGAAACTATACAAGCTGCAAAGGATTCATCTGTAAAACTGGAATGTTTTGCCCTTGGAAATCCAGTCCCCGATATTAGTTGGAGAAGGTTGGACGGGAG
::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::   ::::::::.::::::::::::::.:::::::::::.::
CTGAAACTATACAAGCTGCAAAGGATTCATCTGTAAAACTGGAATGCTTTGCCCTTGGA---CCAGTCCCTGATATTAGTTGGAGGAGGTTGGACGGAAG
P--E--T--I--Q--A--A--K--D--S--S--V--K--L--E--C--F--A--L--G-----P--V--P--D--I--S--W--R--R--L--D--G--S

----------------------------------------------------------------------------------------------------
--P--L--P--G--K--V--K--Y--S--K--S--Q--A--I--L--E--I--P--N--F--Q--Q--E--D--E--G--F--Y--E--C--I--A--S-
CCCGTTGCCAGGGAAAGTCAAGTACAGCAAATCCCAAGCTATCCTTGAAATCCCGAACTTCCAACAAGAAGATGAAGGCTTTTATGAGTGCATTGCAAGC
:::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::.::::::::::::::.:::::.:::::::::.::
CCCATTGCCAGGGAAAGTCAAGTACAGCAAATCCCAAGCTATCCTTGAAATCCCGAACTTTCAACAGGAAGATGAAGGCTTCTATGAATGCATTGCAGGC
--P--L--P--G--K--V--K--Y--S--K--S--Q--A--I--L--E--I--P--N--F--Q--Q--E--D--E--G--F--Y--E--C--I--A--G-

------------------------------------------------><--------------------------------------------------
-N--L--R--G--R--N--L--A--K--G--Q--L--I--F--Y--A--P--P--E--W--E--Q--K--I--Q--N--T--H--L--S--I--Y--D--
AACCTTCGAGGAAGAAACCTTGCAAAGGGTCAACTCATTTTTTATGCTCCTCCAGAATGGGAACAGAAAATCCAAAATACACACCTCTCTATCTATGACA
:::::::::::::::::.::::: ::::::::::: :::::.:::   :::::::::::::::::.::::: :::::::::.:::: :::::::::::::
AACCTTCGAGGAAGAAATCTTGCCAAGGGTCAACTGATTTTCTAT---CCTCCAGAATGGGAACAAAAAATACAAAATACATACCTGTCTATCTATGACA
-N--L--R--G--R--N--L--A--K--G--Q--L--I--F--Y-----P--P--E--W--E--Q--K--I--Q--N--T--Y--L--S--I--Y--D--

-------------------------------------------------------------------------------------><-------------
N--L--L--W--E--C--K--A--S--G--K--P--N--P--W--Y--T--W--L--K--N--G--E--R--L--N--P--E--E--R--I--Q--I--E
ACTTGCTCTGGGAATGTAAAGCTAGTGGAAAGCCAAACCCTTGGTATACATGGTTAAAAAATGGTGAACGACTCAACCCAGAGGAGAGAATTCAAATAGA
.::::.:.::::::::.:::::::::::.:::::::::::::::::.::::::::::::::::::::::: :::::.::::::::.::::::::::::::
GCTTGTTTTGGGAATGCAAAGCTAGTGGGAAGCCAAACCCTTGGTACACATGGTTAAAAAATGGTGAACGCCTCAATCCAGAGGAAAGAATTCAAATAGA
S--L--F--W--E--C--K--A--S--G--K--P--N--P--W--Y--T--W--L--K--N--G--E--R--L--N--P--E--E--R--I--Q--I--E

----------------------------------------------------------------------------------------------------
--N--G--T--L--I--I--T--M--L--N--V--S--D--S--G--V--Y--Q--C--A--A--E--N--K--Y--Q--I--I--Y--A--N--A--E-
AAATGGGACACTCATCATAACGATGCTGAATGTGTCAGATTCTGGTGTGTACCAATGTGCTGCAGAAAACAAATATCAGATAATTTATGCAAATGCTGAA
::::::::::::.:::::::: :::::::::::.::::::::::::.: ::::::::::: :::::::::::::::::::::.::::::::::::: :::
AAATGGGACACTTATCATAACTATGCTGAATGTATCAGATTCTGGTATCTACCAATGTGCAGCAGAAAACAAATATCAGATAGTTTATGCAAATGCAGAA
--N--G--T--L--I--I--T--M--L--N--V--S--D--S--G--I--Y--Q--C--A--A--E--N--K--Y--Q--I--V--Y--A--N--A--E-

---------------><-----------------------------------------------------------------------------------
-L--R--V--L--A--S--A--P--D--F--S--K--S--P--V--K--K--K--S--F--V--Q--V--G--G--D--I--V--I--G--C--K--P--
TTGAGAGTTTTAGCCTCAGCTCCAGATTTCTCCAAAAGTCCAGTTAAAAAAAAGTCTTTTGTTCAAGTTGGTGGGGATATTGTTATCGGATGCAAACCAA
.::::::: :::   :: ::::: :::::::::::::.::: ::::::::::  .  :: :: :::::::::::::::::::. ::::.:::::::::::
CTGAGAGTATTA---TCTGCTCCTGATTTCTCCAAAAATCCCGTTAAAAAAATTCAGTT-GTGCAAGTTGGTGGGGATATTGCAATCGAATGCAAACCAA
-L--R--V--L-----S--A--P--D--F--S--K--N--P--V--K--K--I--Q--F--V--Q--V--G--G--D--I--A--I--E--C--K--P--

---------------------------------------------------------------------><-----------------------------
N--A--F--P--R--A--A--I--S--W--K--R--G--T--E--T--L--R--Q--S--K--R--I--F--L--L--E--D--G--S--L--K--I--Y
ATGCTTTTCCCAGGGCAGCTATCTCTTGGAAAAGAGGAACGGAGACCCTTAGACAAAGCAAAAGAATATTTCTCTTGGAGGATGGCAGCCTCAAGATATA
:::::::.::.::.:: .:::::::.:::::::::::::.:::.: ::: ::::::::::::   .:.:::::: :::::::::::::.:::::::::::
ATGCTTTCCCTAGAGCTACTATCTCCTGGAAAAGAGGAATGGAAAACCTGAGACAAAGCAAA---GTGTTTCTCATGGAGGATGGCAGTCTCAAGATATA
N--A--F--P--R--A--T--I--S--W--K--R--G--M--E--N--L--R--Q--S--K-----V--F--L--M--E--D--G--S--L--K--I--Y

-------------------------------------------------------------------------------------------------><-
--N--I--T--R--S--D--A--G--S--Y--T--C--I--A--T--N--Q--F--G--T--A--K--N--T--G--S--L--I--V--K--E--R--T-
TAATATTACCAGGTCAGATGCTGGATCATATACATGCATAGCCACAAATCAGTTTGGCACTGCAAAGAACACTGGCAGCCTCATTGTAAAAGAGAGAACT
.::..:::::::::::::::: ::::.:::::: :::.::::.::::::::::::::...:::.:::::::::::::::::.:::::::::   ::.:::
CAACGTTACCAGGTCAGATGCGGGATTATATACTTGCGTAGCTACAAATCAGTTTGGTGTTGCGAAGAACACTGGCAGCCTTATTGTAAAA---AGGACT
--N--V--T--R--S--D--A--G--L--Y--T--C--V--A--T--N--Q--F--G--V--A--K--N--T--G--S--L--I--V--K-----R--T-

----------------------------------------------------------------------------------------------------
-V--I--T--V--P--P--S--K--M--D--V--T--V--G--E--S--I--V--L--P--C--Q--V--S--H--D--P--S--I--E--V--V--F--
GTCATTACCGTCCCACCTTCCAAAATGGATGTTACAGTTGGCGAGAGTATAGTGCTACCATGCCAGGTGTCCCATGACCCCTCCATTGAAGTGGTATTTG
::.::::: ::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: :::::::
GTTATTACGGTTCCACCTTCCAAAATGGATGTTACAGTTGGCGAGAGTATAGTGCTACCATGCCAGGTGTCCCATGACCCCTCCATTGAAGTTGTATTTG
-V--I--T--V--P--P--S--K--M--D--V--T--V--G--E--S--I--V--L--P--C--Q--V--S--H--D--P--S--I--E--V--V--F--

-------------------------------------------------------------------------><-------------------------
V--W--F--F--N--G--D--V--I--D--L--K--K--G--V--A--H--F--E--R--I--G--G--E--S--V--G--D--L--M--I--R--N--I
TATGGTTTTTCAATGGAGATGTCATAGACTTAAAAAAAGGAGTGGCTCATTTTGAAAGGATTGGAGGAGAATCTGTTGGGGATTTGATGATAAGGAATAT
::::::.::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::
TATGGTCTTTCAATGGAGATGTCATAGACTTAAAAAAAGGAGTGGCTCATTTTGAGAGGATTGGAGGAGAATCTGTTGGGGATTTGATGATAAGGAATAT
V--W--S--F--N--G--D--V--I--D--L--K--K--G--V--A--H--F--E--R--I--G--G--E--S--V--G--D--L--M--I--R--N--I

-------------------------------------------------------------------------------------------><-------
--Q--L--H--H--S--G--K--Y--L--C--T--V--Q--T--T--L--E--S--L--S--A--V--A--D--I--I--V--R--G--P--P--G--P-
TCAGTTACATCATTCAGGAAAATATCTCTGCACAGTACAAACAACCCTAGAAAGTTTATCTGCAGTAGCCGATATCATTGTTAGAGGTCCACCAGGTCCT
::::::: ::::::::::::::::::: ::::::::: :::::::.:::::::::::::::::::::::.::::::::::: :::               
TCAGTTAAATCATTCAGGAAAATATCTATGCACAGTAAAAACAACTCTAGAAAGTTTATCTGCAGTAGCTGATATCATTGTGAGA---------------
--Q--L--N--H--S--G--K--Y--L--C--T--V--K--T--T--L--E--S--L--S--A--V--A--D--I--I--V--R----------------

----------------------------------------------------------------------------------------------------
-P--E--D--V--Q--V--E--D--I--S--S--T--T--S--Q--L--S--W--R--A--G--P--D--N--N--S--P--I--Q--I--F--T--I--
CCTGAGGATGTGCAAGTGGAAGACATTTCCAGTACTACTTCTCAACTAAGTTGGAGAGCAGGCCCAGATAATAACAGTCCCATTCAAATATTTACTATTC
                                                ::.:::::. :::::.::::::::::.::.:::::::::::::::: :::::
------------------------------------------------AGCTGGAGGCCAGGCTCAGATAATAATAGCCCCATTCAAATATTTAGTATTC
-------------------------------------------------S--W--R--P--G--S--D--N--N--S--P--I--Q--I--F--S--I--

--------------------------------------------------><------------------------------------------------
Q--T--R--T--P--F--S--V--G--W--Q--A--V--A--T--V--P--E--I--L--N--G--K--T--Y--N--A--T--V--V--G--L--S--P
AGACTCGGACACCATTTTCTGTGGGTTGGCAGGCTGTTGCTACAGTTCCAGAAATTCTCAATGGTAAGACATACAATGCAACAGTGGTTGGTTTGAGTCC
::.::::::::::::::::::::::::::::::::::: : :::   ::::::::::::::::::  :::::::::::::::::::::::::::::.:::
AGGCTCGGACACCATTTTCTGTGGGTTGGCAGGCTGTTTCAACA---CCAGAAATTCTCAATGGTCTGACATACAATGCAACAGTGGTTGGTTTGAATCC
Q--A--R--T--P--F--S--V--G--W--Q--A--V--S--T-----P--E--I--L--N--G--L--T--Y--N--A--T--V--V--G--L--N--P

----------------------------------------------------------------------------------------------------
--W--V--E--Y--E--F--R--V--V--A--G--N--S--I--G--I--G--E--P--S--E--P--S--E--L--L--R--T--K--A--S--V--P-
TTGGGTGGAATATGAATTTCGTGTTGTTGCCGGCAACAGCATTGGGATTGGAGAACCAAGTGAACCATCAGAATTGTTAAGAACTAAAGCATCAGTCCCT
::::::::::::::::::::::::::: ::.:: :::::::::::::::::::::::::::.:::::::::::::.:::::.::.:::::::::      
TTGGGTGGAATATGAATTTCGTGTTGTGGCTGGGAACAGCATTGGGATTGGAGAACCAAGTAAACCATCAGAATTATTAAGGACCAAAGCATCA------
--W--V--E--Y--E--F--R--V--V--A--G--N--S--I--G--I--G--E--P--S--K--P--S--E--L--L--R--T--K--A--S-------

><---------------------------------------------------------------------><---------------------------
-V--V--A--P--V--N--I--H--G--G--G--G--S--R--S--E--L--V--I--T--W--E--S--I--P--E--E--L--Q--N--G--E--G--
GTTGTGGCACCAGTAAACATCCATGGAGGTGGAGGAAGTCGGTCTGAACTCGTCATTACGTGGGAGTCAATTCCAGAAGAACTGCAGAATGGGGAGGGAT
                                                                  ::::::::::::::::: ::::::::.::::.::
------------------------------------------------------------------TCAATTCCAGAAGAACTCCAGAATGGAGAGGAAT
-------------------------------------------------------------------S--I--P--E--E--L--Q--N--G--E--E--

----------------------------------------------------------------------------------------------------
F--G--Y--I--I--M--F--R--P--V--G--S--T--T--W--S--K--E--K--V--S--S--V--E--S--S--R--F--V--Y--R--N--E--S
TTGGATATATCATCATGTTCCGGCCAGTGGGCTCGACAACCTGGTCCAAGGAGAAAGTGTCATCTGTGGAATCATCAAGGTTTGTCTACAGAAATGAAAG
:::::::.:::::::::.: :::::::: :::::.::::::::: :::::: .:.:::..:::::::.:::::.:::::::::::.::::::::::::::
TTGGATACATCATCATGCTACGGCCAGTTGGCTCAACAACCTGGACCAAGGCAAGAGTACCATCTGTAGAATCGTCAAGGTTTGTTTACAGAAATGAAAG
F--G--Y--I--I--M--L--R--P--V--G--S--T--T--W--T--K--A--R--V--P--S--V--E--S--S--R--F--V--Y--R--N--E--S

----------------------------------------------------------------------------------------------------
--I--I--P--L--S--P--F--E--V--K--V--G--V--Y--N--N--E--G--E--G--S--L--S--T--V--T--I--V--Y--S--G--E--D-
CATCATCCCACTGTCTCCCTTTGAAGTCAAAGTGGGTGTGTATAATAATGAAGGAGAAGGATCCCTGAGTACTGTGACCATTGTCTACTCTGGGGAAGAT
::::::.:: :: ::::::::::::::::::::::: ::::::::.::::::::::::::: ::::::::::::.: :::::::::::::::::::::::
CATCATTCCCCTCTCTCCCTTTGAAGTCAAAGTGGGGGTGTATAACAATGAAGGAGAAGGAGCCCTGAGTACTGCGTCCATTGTCTACTCTGGGGAAGAT
--I--I--P--L--S--P--F--E--V--K--V--G--V--Y--N--N--E--G--E--G--A--L--S--T--A--S--I--V--Y--S--G--E--D-

------><--------------------------------------------------------------------------------------------
-E--P--Q--L--A--P--R--G--T--S--L--Q--S--F--S--A--S--E--M--E--V--S--W--N--A--I--A--W--N--R--N--T--G--
GAACCTCAACTGGCCCCAAGGGGAACTTCTCTCCAGAGTTTTTCTGCTTCTGAAATGGAGGTTTCATGGAATGCTATTGCCTGGAATAGAAACACTGGAA
   ::.::.::::::::::::::::::::: :.::.:::::::::::::: :::::::::::::::::::::::::::::::::::::::::.:::::::
---CCCCAGCTGGCCCCAAGGGGAACTTCTGTTCAAAGTTTTTCTGCTTCAGAAATGGAGGTTTCATGGAATGCTATTGCCTGGAATAGAAATACTGGAA
----P--Q--L--A--P--R--G--T--S--V--Q--S--F--S--A--S--E--M--E--V--S--W--N--A--I--A--W--N--R--N--T--G--

----------------------><----------------------------------------------------------------------------
R--V--L--G--Y--E--V--L--Y--W--T--D--D--S--K--E--S--M--I--G--K--I--R--V--S--G--N--V--T--T--K--N--I--T
GAGTGCTGGGCTATGAGGTCTTATACTGGACAGATGACTCCAAAGAATCCATGATAGGTAAAATTAGAGTCAGTGGAAATGTCACAACCAAAAACATCAC
:::: :::::.::::::   ::::::::::::::::::::::::::::::::::: ::::::.:::::::::::::::::::::::::::::::::::::
GAGTTCTGGGTTATGAG---TTATACTGGACAGATGACTCCAAAGAATCCATGATTGGTAAAGTTAGAGTCAGTGGAAATGTCACAACCAAAAACATCAC
R--V--L--G--Y--E-----L--Y--W--T--D--D--S--K--E--S--M--I--G--K--V--R--V--S--G--N--V--T--T--K--N--I--T

----------------------------------------------------------------------------------------------------
--G--L--K--A--N--T--I--Y--F--A--S--V--R--A--Y--N--T--A--G-----T--G--P--S--S--P--P--V--N--V--T--T--K-
GGGGCTGAAAGCTAATACCATCTACTTTGCTTCCGTAAGAGCTTACAACACTGCTGGG---ACAGGGCCCTCAAGCCCCCCAGTCAATGTTACCACCAAA
.::.:: ::::::::.::..:.:::::::::::.::.::::::::.::::::::::::   ::::::::.:::::.:::                     
AGGACTCAAAGCTAACACTGTTTACTTTGCTTCTGTGAGAGCTTATAACACTGCTGGGG--ACAGGGCCTTCAAGTCCC---------------------
--G--L--K--A--N--T--V--Y--F--A--S--V--R--A--Y--N--T--A--G--\--T--G--P--S--S--P----------------------

------------><--------------------------------------------------------------------------------------
-K--S--P--P--S--Q--P--P--A--N--I--A--W--K--L--T--N--S--K--L--C--L--N--W--E--H--V--K--T--M--E--N--E--
AAGTCTCCTCCAAGCCAACCACCAGCAAACATTGCCTGGAAGCTGACAAACTCTAAATTATGCTTGAACTGGGAGCATGTAAAAACCATGGAAAATGAGT
         :::::.::::::::::: :::::::::::::::::::::::.:::::::::::..:.::::::::.:::::::::::::::::::::::::
---------CCAAGTCAACCACCAGCTAACATTGCCTGGAAGCTGACAAATTCTAAATTATGTCTAAACTGGGAACATGTAAAAACCATGGAAAATGAGT
----------P--S--Q--P--P--A--N--I--A--W--K--L--T--N--S--K--L--C--L--N--W--E--H--V--K--T--M--E--N--E--

-------------------------><-------------------------------------------------------------------------
S--E--V--L--G--Y--K--I--L--Y--R--Q--N--R--Q--S--K--T--H--I--L--E--T--N--N--T--S--A--E--L--L--V--P--F
CTGAAGTTTTGGGGTACAAGATTCTGTACCGGCAAAACAGACAGAGTAAAACTCATATTTTGGAAACAAACAATACATCAGCTGAGCTTCTGGTTCCATT
::::::: ::::: :::::::::::.::::::::::::::::::::: :::::::::::::::::::::::::.::::: ::::::::::::::::::::
CTGAAGTATTGGGTTACAAGATTCTATACCGGCAAAACAGACAGAGTCAAACTCATATTTTGGAAACAAACAACACATCTGCTGAGCTTCTGGTTCCATT
S--E--V--L--G--Y--K--I--L--Y--R--Q--N--R--Q--S--Q--T--H--I--L--E--T--N--N--T--S--A--E--L--L--V--P--F

----------------------------------------------------------------------------------------------><----
--E--E--D--Y--L--I--E--I--R--T--V--S--D--G--G--D--G--S--S--S--E--E--I--R--I--P--K--M--S--S--L--S--S-
TGAAGAAGACTACTTAATTGAAATAAGAACAGTCAGTGATGGTGGAGATGGAAGCAGCAGTGAGGAAATTAGGATTCCAAAAATGTCAAGTTTGAGTTCC
::::::.::::::::.:::::::::::::::::.:::::::::::.::::::::::::::::::::::::::::::::::::::::::            
TGAAGAGGACTACTTGATTGAAATAAGAACAGTTAGTGATGGTGGGGATGGAAGCAGCAGTGAGGAAATTAGGATTCCAAAAATGTCA------------
--E--E--D--Y--L--I--E--I--R--T--V--S--D--G--G--D--G--S--S--S--E--E--I--R--I--P--K--M--S-------------

------------------------------------------------------------------------------------------
-R--G--I--Q--F--L--E--P--S--T--H--F--L--S--I--V--I--V--I--F--H--C--F--A--I--Q--P--L--I--*-
AGAGGAATTCAATTCTTAGAACCTAGCACCCATTTTCTTTCCATTGTCATTGTGATTTTTCACTGTTTTGCTATTCAGCCACTTATCTGA
                                                                                          
------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000902659
ATGAGGTTGCTATGGAAACTGGTAATTCTGCTGCCACTCATAAATACT---------GATGGCCATTTGAGCCATCCTATTTTTACCCAGGAACCACAGG
ATGTTATTTTTCCTTTGGATTTGTCAAAATCTGAAATCATCCTGAATTGTGCTGCAAATGGTTATCCTTCGCCCCATTAT---TGGAAGCAAAATGGCAC
AGATATTGATTTTACCATGAGTTATCACTACAGGTTGGATGGAGGCAATTTGGCAATCAGTAGCCCCCGCACAGACCAAGATATTGGCACATACCAGTGC
CTGGCCACCAACCCTCTAGGAACAATTTTAAGTCGGAAGGCGAAGCTCCAATTTGCA---ATTGAAGACTTTGAAACCAAAACAAGAAGCACAGTGTCTG
TCCGAGAAGGTCAAGGTGTGGTGCTTCTCTGTGGTCCACCACCACACTTTGGA---TTATCTTATGCATGGACTTTCAATGATAACCCCTTATATGTCCA
AGAGGACAAGAGACGagTATCACAAGAGACAGGAAACTTGTACATTGCCAAAGTGGAACCATCAGATGTTGGCAACTACACCTGCTTCATAACCAATAAG
GAAGCCCAGAGGAGTGTTCAAGGACCGCCCACTCCATTAGTTCAGCGCACTGAT---GTGATGGGGGAATATGAACCAAAGATTGAAGTACGTTTTCCTG
AAACTATACAAGCTGCAAAGGATTCATCTGTAAAACTGGAATGCTTTGCCCTTGGA---CCAGTCCCTGATATTAGTTGGAGGAGGTTGGACGGAAGCCC
ATTGCCAGGGAAAGTCAAGTACAGCAAATCCCAAGCTATCCTTGAAATCCCGAACTTTCAACAGGAAGATGAAGGCTTCTATGAATGCATTGCAGGCAAC
CTTCGAGGAAGAAATCTTGCCAAGGGTCAACTGATTTTCTAT---CCTCCAGAATGGGAACAAAAAATACAAAATACATACCTGTCTATCTATGACAGCT
TGTTTTGGGAATGCAAAGCTAGTGGGAAGCCAAACCCTTGGTACACATGGTTAAAAAATGGTGAACGCCTCAATCCAGAGGAAAGAATTCAAATAGAAAA
TGGGACACTTATCATAACTATGCTGAATGTATCAGATTCTGGTATCTACCAATGTGCAGCAGAAAACAAATATCAGATAGTTTATGCAAATGCAGAACTG
AGAGTATTA---TCTGCTCCTGATTTCTCCAAAAATCCCGTTAAAAAAATTCAggTGCAAGTTGGTGGGGATATTGCAATCGAATGCAAACCAAATGCTT
TCCCTAGAGCTACTATCTCCTGGAAAAGAGGAATGGAAAACCTGAGACAAAGCAAA---GTGTTTCTCATGGAGGATGGCAGTCTCAAGATATACAACGT
TACCAGGTCAGATGCGGGATTATATACTTGCGTAGCTACAAATCAGTTTGGTGTTGCGAAGAACACTGGCAGCCTTATTGTAAAA---AGGACTGTTATT
ACGGTTCCACCTTCCAAAATGGATGTTACAGTTGGCGAGAGTATAGTGCTACCATGCCAGGTGTCCCATGACCCCTCCATTGAAGTTGTATTTGTATGGT
CTTTCAATGGAGATGTCATAGACTTAAAAAAAGGAGTGGCTCATTTTGAGAGGATTGGAGGAGAATCTGTTGGGGATTTGATGATAAGGAATATTCAGTT
AAATCATTCAGGAAAATATCTATGCACAGTAAAAACAACTCTAGAAAGTTTATCTGCAGTAGCTGATATCATTGTGAGA---------------------
------------------------------------------AGCTGGAGGCCAGGCTCAGATAATAATAGCCCCATTCAAATATTTAGTATTCAGGCTC
GGACACCATTTTCTGTGGGTTGGCAGGCTGTTTCAACA---CCAGAAATTCTCAATGGTCTGACATACAATGCAACAGTGGTTGGTTTGAATCCTTGGGT
GGAATATGAATTTCGTGTTGTGGCTGGGAACAGCATTGGGATTGGAGAACCAAGTAAACCATCAGAATTATTAAGGACCAAAGCATCA------------
------------------------------------------------------------TCAATTCCAGAAGAACTCCAGAATGGAGAGGAATTTGGAT
ACATCATCATGCTACGGCCAGTTGGCTCAACAACCTGGACCAAGGCAAGAGTACCATCTGTAGAATCGTCAAGGTTTGTTTACAGAAATGAAAGCATCAT
TCCCCTCTCTCCCTTTGAAGTCAAAGTGGGGGTGTATAACAATGAAGGAGAAGGAGCCCTGAGTACTGCGTCCATTGTCTACTCTGGGGAAGAT---CCC
CAGCTGGCCCCAAGGGGAACTTCTGTTCAAAGTTTTTCTGCTTCAGAAATGGAGGTTTCATGGAATGCTATTGCCTGGAATAGAAATACTGGAAGAGTTC
TGGGTTATGAG---TTATACTGGACAGATGACTCCAAAGAATCCATGATTGGTAAAGTTAGAGTCAGTGGAAATGTCACAACCAAAAACATCACAGGACT
CAAAGCTAACACTGTTTACTTTGCTTCTGTGAGAGCTTATAACACTGCTGGgaCAGGGCCTTCAAGTCCC------------------------------
CCAAGTCAACCACCAGCTAACATTGCCTGGAAGCTGACAAATTCTAAATTATGTCTAAACTGGGAACATGTAAAAACCATGGAAAATGAGTCTGAAGTAT
TGGGTTACAAGATTCTATACCGGCAAAACAGACAGAGTCAAACTCATATTTTGGAAACAAACAACACATCTGCTGAGCTTCTGGTTCCATTTGAAGAGGA
CTACTTGATTGAAATAAGAACAGTTAGTGATGGTGGGGATGGAAGCAGCAGTGAGGAAATTAGGATTCCAAAAATGTCA---------------------
---------------------------------------------------------------------------------


>BGISUSP0000902659
MRLLWKLVILLPLINT---DGHLSHPIFTQEPQDVIFPLDLSKSEIILNCAANGYPSPHY-WKQNGTDIDFTMSYHYRLDGGNLAISSPRTDQDIGTYQC
LATNPLGTILSRKAKLQFA-IEDFETKTRSTVSVREGQGVVLLCGPPPHFG-LSYAWTFNDNPLYVQEDKRRVSQETGNLYIAKVEPSDVGNYTCFITNK
EAQRSVQGPPTPLVQRTD-VMGEYEPKIEVRFPETIQAAKDSSVKLECFALG-PVPDISWRRLDGSPLPGKVKYSKSQAILEIPNFQQEDEGFYECIAGN
LRGRNLAKGQLIFY-PPEWEQKIQNTYLSIYDSLFWECKASGKPNPWYTWLKNGERLNPEERIQIENGTLIITMLNVSDSGIYQCAAENKYQIVYANAEL
RVL-SAPDFSKNPVKKIQVQVGGDIAIECKPNAFPRATISWKRGMENLRQSK-VFLMEDGSLKIYNVTRSDAGLYTCVATNQFGVAKNTGSLIVK-RTVI
TVPPSKMDVTVGESIVLPCQVSHDPSIEVVFVWSFNGDVIDLKKGVAHFERIGGESVGDLMIRNIQLNHSGKYLCTVKTTLESLSAVADIIVR-------
--------------SWRPGSDNNSPIQIFSIQARTPFSVGWQAVST-PEILNGLTYNATVVGLNPWVEYEFRVVAGNSIGIGEPSKPSELLRTKAS----
--------------------SIPEELQNGEEFGYIIMLRPVGSTTWTKARVPSVESSRFVYRNESIIPLSPFEVKVGVYNNEGEGALSTASIVYSGED-P
QLAPRGTSVQSFSASEMEVSWNAIAWNRNTGRVLGYE-LYWTDDSKESMIGKVRVSGNVTTKNITGLKANTVYFASVRAYNTAGTGPSSP----------
PSQPPANIAWKLTNSKLCLNWEHVKTMENESEVLGYKILYRQNRQSQTHILETNNTSAELLVPFEEDYLIEIRTVSDGGDGSSSEEIRIPKMS-------
---------------------------