Sequences
EST Library Info
hlv2Heart, left ventricle
nco2Newborn 115 days, colon
Clusters
Oligos
SNPs

Gene ID ENSG00000172273 (click for geneview)
Transcript ID ENST00000350777(link to ensembl)
Symbol MIZF_HUMAN
Localtion Chromosome:11:118497498:118510974:1 band: 11q23.3
Description MBD2-interacting zinc finger protein (Methyl-CpG-binding protein 2- interacting zinc finger protein).
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--P--P--P--G--K--V--P--R--K--E--N--L--W--L--Q--C--E--W--G--S--C--S--F--V--C--S--T--M--E--K--F--F--
ATGCCGCCTCCTGGGAAAGTTCCCCGAAAGGAGAATCTGTGGCTACAGTGTGAGTGGGGGTCCTGCTCCTTTGTGTGCTCAACCATGGAAAAGTTCTTTG
::::::::.:::::::::::::::::::: :::::.::: :.::.:::::::::::::::::::::::::::::::::::..:::::::..:::::: .:
ATGCCGCCCCCTGGGAAAGTTCCCCGAAATGAGAACCTGGGACTGCAGTGTGAGTGGGGGTCCTGCTCCTTTGTGTGCTCGGCCATGGAGGAGTTCTGCG
-M--P--P--P--G--K--V--P--R--N--E--N--L--G--L--Q--C--E--W--G--S--C--S--F--V--C--S--A--M--E--E--F--C--

--------------------------------------------------------------------------------><------------------
E--H--V--T--Q--H--L--Q--Q--H--L--H--G--S--G--E--E--E--E--E--E--E--E--D--D--P--L--E--E--E--F--S--C--L
AGCATGTCACTCAGCACCTGCAGCAGCACCTGCATGGCTCTGGGGAGGAGGAGGAAGAGGAAGAGGAGGATGACCCACTTGAGGAAGAATTCTCCTGCTT
::::.::::::::::::.:::::::::::::::: :::::.:::::::::::.::.:::::.:::                  :::::::::::::::::
AGCACGTCACTCAGCACTTGCAGCAGCACCTGCAGGGCTCCGGGGAGGAGGAAGAGGAGGAGGAG------------------GAAGAATTCTCCTGCTT
E--H--V--T--Q--H--L--Q--Q--H--L--Q--G--S--G--E--E--E--E--E--E--E--------------------E--E--F--S--C--L

----------------------------------------------------------------------------------------------------
--W--Q--E--C--G--F--C--S--L--D--S--S--A--D--L--I--R--H--V--Y--F--H--C--Y--H--T--K--L--K--Q--W--G--L-
GTGGCAGGAATGTGGCTTTTGTTCTCTGGACAGTTCTGCTGACCTCATCCGCCATGTCTACTTCCACTGCTACCACACCAAGCTGAAACAGTGGGGGCTG
:::::::::.::.::::::::.::::::::::.::::::.: .:::.::::::::::::::::::::::::::::::::::::::::.::::::::::::
GTGGCAGGAGTGCGGCTTTTGCTCTCTGGACAATTCTGCCGCTCTCGTCCGCCATGTCTACTTCCACTGCTACCACACCAAGCTGAAGCAGTGGGGGCTG
--W--Q--E--C--G--F--C--S--L--D--N--S--A--A--L--V--R--H--V--Y--F--H--C--Y--H--T--K--L--K--Q--W--G--L-

----------------------------------------------------------------------------------------------------
-Q--A--L--Q--S--Q--A--D--L--G--P--C--I--L--D--F--Q--S--R--N--V--I--P--D--I--P--D--H--F--L--C--L--W--
CAGGCCTTGCAAAGCCAGGCTGACCTTGGCCCCTGCATCCTGGACTTCCAGAGCCGGAACGTCATCCCTGATATCCCTGACCACTTCCTGTGTCTGTGGG
::::: .::::.::::::::.:::::..:::: ::::::::::::::::::::::: ::: ::::::::::.::::::::::::::::::::::::::::
CAGGCGCTGCAGAGCCAGGCCGACCTCAGCCCGTGCATCCTGGACTTCCAGAGCCGCAACCTCATCCCTGACATCCCTGACCACTTCCTGTGTCTGTGGG
-Q--A--L--Q--S--Q--A--D--L--S--P--C--I--L--D--F--Q--S--R--N--L--I--P--D--I--P--D--H--F--L--C--L--W--

----------><----------------------------------------------------------------------------------------
E--H--C--E--N--S--F--D--N--P--E--W--F--Y--R--H--V--E--A--H--S--L--C--C--E--Y--E--A--V--G--K--D--N--P
AGCACTGTGAGAATTCCTTCGACAATCCTGAGTGGTTTTATCGGCATGTGGAAGCACACAGTCTGTGCTGTGAATACGAAGCAGTCGGCAAGGACAACCC
:::::::::::   :::::::::::.::.::::::::.::::::::.:::::::: :::::.::::::::::::::: ::.:: ::::::::::::::: 
AGCACTGTGAG---TCCTTCGACAACCCCGAGTGGTTCTATCGGCACGTGGAAGCTCACAGCCTGTGCTGTGAATACCAAACATTCGGCAAGGACAACCA
E--H--C--E-----S--F--D--N--P--E--W--F--Y--R--H--V--E--A--H--S--L--C--C--E--Y--Q--T--F--G--K--D--N--H

----------------------><----------------------------------------------------------------------------
--V--V--L--C--G--W--K--G--C--T--C--T--F--K--D--R--S--K--L--R--E--H--L--R--S--H--T--Q--E--K--V--V--A-
GGTGGTGCTGTGTGGCTGGAAAGGCTGTACCTGCACCTTCAAGGACCGCAGTAAACTTCGAGAGCACCTCCGCAGCCATACCCAGGAGAAAGTGGTAGCC
 :::::::..::::::::::::   ::.:::::::::::::::::::::  :::.:::::::::::::::::::::::::::::::::::.:::::.:::
TGTGGTGCCATGTGGCTGGAAA---TGCACCTGCACCTTCAAGGACCGCTTTAAGCTTCGAGAGCACCTCCGCAGCCATACCCAGGAGAAGGTGGTGGCC
--V--V--P--C--G--W--K-----C--T--C--T--F--K--D--R--F--K--L--R--E--H--L--R--S--H--T--Q--E--K--V--V--A-

---------------------------------------------------------------------------><-----------------------
-C--P--T--C--G--G--M--F--A--N--N--T--K--F--L--D--H--I--R--R--Q--T--S--L--D--Q--Q--H--F--Q--C--S--H--
TGCCCCACCTGTGGGGGCATGTTTGCCAACAATACCAAGTTCTTAGATCACATCCGTCGCCAGACCTCATTGGATCAGCAGCACTTCCAGTGTTCTCACT
:::::::::::.::::::::::::::::::::.::::::::::::::::::::::::::.:::::::::::::::   ::.:::::::::::.:::::::
TGCCCCACCTGCGGGGGCATGTTTGCCAACAACACCAAGTTCTTAGATCACATCCGTCGTCAGACCTCATTGGAT---CAACACTTCCAGTGCTCTCACT
-C--P--T--C--G--G--M--F--A--N--N--T--K--F--L--D--H--I--R--R--Q--T--S--L--D-----Q--H--F--Q--C--S--H--

-----------------------------------------------------><---------------------------------------------
C--S--K--R--F--A--T--E--R--L--L--R--D--H--M--R--N--H--V--N--H--Y--K--C--P--L--C--D--M--T--C--P--L--P
GTTCCAAGAGATTTGCCACAGAGCGGCTATTGCGGGACCACATGCGCAACCATGTGAATCACTATAAGTGCCCTCTGTGTGACATGACCTGCCCGCTGCC
::::::::::.:::::.:::::::::::..::::::::::::::::.::::::   ::.:::::::::::::::::::::::::::::::::::::::::
GTTCCAAGAGGTTTGCTACAGAGCGGCTGCTGCGGGACCACATGCGTAACCAT---AACCACTATAAGTGCCCTCTGTGTGACATGACCTGCCCGCTGCC
C--S--K--R--F--A--T--E--R--L--L--R--D--H--M--R--N--H-----N--H--Y--K--C--P--L--C--D--M--T--C--P--L--P

--------------------------------------------------------------------------><------------------------
--S--S--L--R--N--H--M--R--F--R--H--S--E--D--R--P--F--K--C--D--C--C--D--Y--S--C--K--N--L--I--D--L--Q-
TTCCTCCCTCCGCAACCACATGCGCTTTCGTCACAGTGAGGACCGGCCCTTTAAATGTGACTGTTGTGACTACAGCTGCAAGAATCTTATTGACCTCCAG
 ::::::::::: :::::::::::::::::.:::::.:::::::: :::::::::::::::::::::::::::   ::::::::::: ::.:::::::.:
ATCCTCCCTCCGAAACCACATGCGCTTTCGCCACAGCGAGGACCGTCCCTTTAAATGTGACTGTTGTGACTAC---TGCAAGAATCTGATCGACCTCCGG
--S--S--L--R--N--H--M--R--F--R--H--S--E--D--R--P--F--K--C--D--C--C--D--Y-----C--K--N--L--I--D--L--R-

----------------------------------------------------------------------------------------------------
-K--H--L--D--T--H--S--E--E--P--A--Y--R--C--D--F--E--N--C--T--F--S--A--R--S--L--C--S--I--K--S--H--Y--
AAGCACCTGGATACCCACAGCGAGGAGCCAGCCTACAGGTGTGATTTTGAGAACTGCACCTTCAGTGCCCGATCCCTCTGCTCTATCAAGTCCCATTACC
::::::::: ::::::::::.::::::::::::: ::::::::::::::::::::::::::::::::::::.:: ::::::::::::::::::::::.::
AAGCACCTGCATACCCACAGTGAGGAGCCAGCCTTCAGGTGTGATTTTGAGAACTGCACCTTCAGTGCCCGGTCACTCTGCTCTATCAAGTCCCATTGCC
-K--H--L--H--T--H--S--E--E--P--A--F--R--C--D--F--E--N--C--T--F--S--A--R--S--L--C--S--I--K--S--H--C--

-------------><-------------------------------------------------------------------------------------
R--K--V--H--E--G--D--S--E--P--R--Y--K--C--H--V--C--D--K--C--F--T--R--G--N--N--L--T--V--H--L--R--K--K
GCAAAGTACATGAAGGAGACTCTGAGCCAAGGTACAAATGTCATGTGTGTGACAAATGCTTCACACGGGGCAACAACCTCACCGTGCACCTTCGCAAGAA
: ::::::::.::::::::::: :::::::::::::.:::.:::::::::::::::::::::::: ::::::::::::::::.:::::::::::::::::
GAAAAGTACACGAAGGAGACTCAGAGCCAAGGTACAGATGCCATGTGTGTGACAAATGCTTCACAAGGGGCAACAACCTCACTGTGCACCTTCGCAAGAA
R--K--V--H--E--G--D--S--E--P--R--Y--R--C--H--V--C--D--K--C--F--T--R--G--N--N--L--T--V--H--L--R--K--K

--------------------------------------><------------------------------------------------------------
--H--Q--F--K--W--P--S--G--H--P--R--F--R--Y--K--E--H--E--D--G--Y--M--R--L--Q--L--V--R--Y--E--S--V--E-
GCACCAGTTCAAGTGGCCCTCAGGGCATCCCCGTTTTCGGTACAAGGAACATGAAGATGGCTATATGCGGCTGCAGCTGGTTCGCTACGAGAGTGTAGAG
::::::::::::::::::::: :::::.:::::::::   ::::::::.::::::::.:::::.:::::::::::::::::::::::.::.::.::.:::
GCACCAGTTCAAGTGGCCCTCTGGGCACCCCCGTTTT---TACAAGGAGCATGAAGACGGCTACATGCGGCTGCAGCTGGTTCGCTATGAAAGCGTGGAG
--H--Q--F--K--W--P--S--G--H--P--R--F-----Y--K--E--H--E--D--G--Y--M--R--L--Q--L--V--R--Y--E--S--V--E-

----------------------------------------------------------------------------------------------------
-L--T--Q--Q--L--L--R--Q--P--Q--E--G--S--G--L--G--T--S--L--N--E--S--S--L--Q--G--I--I--L--E--T--V--P--
CTGACACAGCAACTGCTGCGGCAACCACAAGAGGGATCGGGCCTGGGAACGTCGCTGAACGAGAGCAGCCTGCAGGGCATTATTCTAGAAACAGTGCCAG
:::::.:::::.:::::::.:::.:.::::::::::::.:::::.:::.:.::.:::::.::::::::::::::::::::.:::::::::::::::::::
CTGACGCAGCAGCTGCTGCAGCAGCTACAAGAGGGATCAGGCCTAGGAGCATCACTGAATGAGAGCAGCCTGCAGGGCATCATTCTAGAAACAGTGCCAG
-L--T--Q--Q--L--L--Q--Q--L--Q--E--G--S--G--L--G--A--S--L--N--E--S--S--L--Q--G--I--I--L--E--T--V--P--

----------------------------------------------------------------------------------------------------
G--E--P--G-----------R--K--E--E--E--E--E--G--K--G--S--E--G--T--A--L--S--A--S--Q--D--N--P--S--S--V--I
GGGAGCCAGGA---------CGTAAGGAAGAGGAAGAGGAGGGCAAGGGTAGCGAAGGGACAGCCCTCTCAGCCTCTCAGGACAACCCCAGTTCTGTCAT
:::::::::::          . . .:::::::::::::::::::.: ::.:.::.::::::::::.:::.::::::::::::: ..:::...:::::.:
GGGAGCCAGGACCCCCGGAAGAGGTAGAAGAGGAAGAGGAGGGCAGGCGTGGTGAGGGGACAGCCCCCTCGGCCTCTCAGGACACTTCCAACCCTGTCGT
G--E--P--G--P--P--E--E--V--E--E--E--E--E--G--R--R--G--E--G--T--A--P--S--A--S--Q--D--T--S--N--P--V--V

----------------------------------------------------------------------------------------------------
--H--V--V--N--Q--T--N--A--Q--G--Q--Q--E--I--V--Y--Y--V--L--S--E--A--P--G--E--P--P--P--A--P--E--P--P-
CCACGTGGTGAATCAGACCAATGCCCAAGGCCAGCAAGAGATCGTCTACTATGTGCTGTCTGAAGCCCCAGGGGAGCCTCCCCCAGCCCCTGAGCCACCT
:::.: :: :::::::::::..:.::::::  :.:.:::::::::::::::.:::::::::::.:::::.::.:::::.:::::::::::.::::: : .
CCATGGGGAGAATCAGACCAGCGTCCAAGGAGAACGAGAGATCGTCTACTACGTGCTGTCTGAGGCCCCGGGAGAGCCCCCCCCAGCCCCCGAGCCCCGC
--H--G--E--N--Q--T--S--V--Q--G--E--R--E--I--V--Y--Y--V--L--S--E--A--P--G--E--P--P--P--A--P--E--P--R-

-------------------------------------------------------------->
-S--G--G--I--M--E--K--L--Q--G--I--A--E--E--P--E--I--Q--M--V--*-
TCAGGGGGCATCATGGAAAAGCTTCAAGGAATAGCTGAGGAGCCAGAGATCCAGATGGTTTGA
:..::::. .::::::::::::::::.::::::::::::::::::::..:::::::::: :::
TTGGGGGAAGTCATGGAAAAGCTTCAGGGAATAGCTGAGGAGCCAGAAGTCCAGATGGTGTGA
-L--G--E--V--M--E--K--L--Q--G--I--A--E--E--P--E--V--Q--M--V--*-

Pig Consensus Sequence

>BGISUST0000901692
ATGCCGCCCCCTGGGAAAGTTCCCCGAAATGAGAACCTGGGACTGCAGTGTGAGTGGGGGTCCTGCTCCTTTGTGTGCTCGGCCATGGAGGAGTTCTGCG
AGCACGTCACTCAGCACTTGCAGCAGCACCTGCAGGGCTCCGGGGAGGAGGAAGAGGAGGAGGAG------------------GAAGAATTCTCCTGCTT
GTGGCAGGAGTGCGGCTTTTGCTCTCTGGACAATTCTGCCGCTCTCGTCCGCCATGTCTACTTCCACTGCTACCACACCAAGCTGAAGCAGTGGGGGCTG
CAGGCGCTGCAGAGCCAGGCCGACCTCAGCCCGTGCATCCTGGACTTCCAGAGCCGCAACCTCATCCCTGACATCCCTGACCACTTCCTGTGTCTGTGGG
AGCACTGTGAG---TCCTTCGACAACCCCGAGTGGTTCTATCGGCACGTGGAAGCTCACAGCCTGTGCTGTGAATACCAAACATTCGGCAAGGACAACCA
TGTGGTGCCATGTGGCTGGAAA---TGCACCTGCACCTTCAAGGACCGCTTTAAGCTTCGAGAGCACCTCCGCAGCCATACCCAGGAGAAGGTGGTGGCC
TGCCCCACCTGCGGGGGCATGTTTGCCAACAACACCAAGTTCTTAGATCACATCCGTCGTCAGACCTCATTGGAT---CAACACTTCCAGTGCTCTCACT
GTTCCAAGAGGTTTGCTACAGAGCGGCTGCTGCGGGACCACATGCGTAACCAT---AACCACTATAAGTGCCCTCTGTGTGACATGACCTGCCCGCTGCC
ATCCTCCCTCCGAAACCACATGCGCTTTCGCCACAGCGAGGACCGTCCCTTTAAATGTGACTGTTGTGACTAC---TGCAAGAATCTGATCGACCTCCGG
AAGCACCTGCATACCCACAGTGAGGAGCCAGCCTTCAGGTGTGATTTTGAGAACTGCACCTTCAGTGCCCGGTCACTCTGCTCTATCAAGTCCCATTGCC
GAAAAGTACACGAAGGAGACTCAGAGCCAAGGTACAGATGCCATGTGTGTGACAAATGCTTCACAAGGGGCAACAACCTCACTGTGCACCTTCGCAAGAA
GCACCAGTTCAAGTGGCCCTCTGGGCACCCCCGTTTT---TACAAGGAGCATGAAGACGGCTACATGCGGCTGCAGCTGGTTCGCTATGAAAGCGTGGAG
CTGACGCAGCAGCTGCTGCAGCAGCTACAAGAGGGATCAGGCCTAGGAGCATCACTGAATGAGAGCAGCCTGCAGGGCATCATTCTAGAAACAGTGCCAG
GGGAGCCAGGACCCCCGGAAGAGGTAGAAGAGGAAGAGGAGGGCAGGCGTGGTGAGGGGACAGCCCCCTCGGCCTCTCAGGACACTTCCAACCCTGTCGT
CCATGGGGAGAATCAGACCAGCGTCCAAGGAGAACGAGAGATCGTCTACTACGTGCTGTCTGAGGCCCCGGGAGAGCCCCCCCCAGCCCCCGAGCCCCGC
TTGGGGGAAGTCATGGAAAAGCTTCAGGGAATAGCTGAGGAGCCAGAAGTCCAG


>BGISUSP0000901692
MPPPGKVPRNENLGLQCEWGSCSFVCSAMEEFCEHVTQHLQQHLQGSGEEEEEEE------EEFSCLWQECGFCSLDNSAALVRHVYFHCYHTKLKQWGL
QALQSQADLSPCILDFQSRNLIPDIPDHFLCLWEHCE-SFDNPEWFYRHVEAHSLCCEYQTFGKDNHVVPCGWK-CTCTFKDRFKLREHLRSHTQEKVVA
CPTCGGMFANNTKFLDHIRRQTSLD-QHFQCSHCSKRFATERLLRDHMRNH-NHYKCPLCDMTCPLPSSLRNHMRFRHSEDRPFKCDCCDY-CKNLIDLR
KHLHTHSEEPAFRCDFENCTFSARSLCSIKSHCRKVHEGDSEPRYRCHVCDKCFTRGNNLTVHLRKKHQFKWPSGHPRF-YKEHEDGYMRLQLVRYESVE
LTQQLLQQLQEGSGLGASLNESSLQGIILETVPGEPGPPEEVEEEEEGRRGEGTAPSASQDTSNPVVHGENQTSVQGEREIVYYVLSEAPGEPPPAPEPR
LGEVMEKLQGIAEEPEVQ