Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000134183 (click for geneview)
Transcript ID ENST00000351050(link to ensembl)
Symbol GNAT2
Localtion Chromosome:1:109857817:109867747:-1 band: 1p13.3
Description Guanine nucleotide-binding protein G(t), alpha-2 subunit (Transducin alpha-2 chain). [Source:Uniprot/SWISSPROT;Acc:P19087]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--G--S--G--A--S--A--E--D--K--E--L--A--K--R--S--K--E--L--E--K--K--L--Q--E--D--A--D--K--E--A--K--T--
ATGGGAAGTGGAGCCAGTGCTGAGGACAAAGAACTGGCCAAGAGGTCCAAGGAGCTAGAAAAGAAGCTGCAGGAGGATGCTGATAAGGAAGCCAAGACTG
:::::.::::::::::::::::::::::::::::::::: :::::::::::::::::::::::::::::::::::::::::::.::::::::::::::.:
ATGGGGAGTGGAGCCAGTGCTGAGGACAAAGAACTGGCCTAGAGGTCCAAGGAGCTAGAAAAGAAGCTGCAGGAGGATGCTGACAAGGAAGCCAAGACCG
-M--G--S--G--A--S--A--E--D--K--E--L--A--*--R--S--K--E--L--E--K--K--L--Q--E--D--A--D--K--E--A--K--T--

-----------------><-----------------------------------------><--------------------------------------
V--K--L--L--L--L--G--A--G--E--S--G--K--S--T--I--V--K--Q--M--K--I--I--H--Q--D--G--Y--S--P--E--E--C--L
TCAAGCTGCTACTGCTGGGTGCTGGGGAGTCAGGAAAGAGCACCATCGTCAAACAGATGAAGATCATTCACCAGGATGGCTATTCACCAGAAGAATGCCT
:::::::::::.:::::                                                                                   
TCAAGCTGCTATTGCTG-----------------------------------------------------------------------------------
V--K--L--L--L--L------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--E--F--K--A--I--I--Y--G--N--V--L--Q--S--I--L--A--I--I--R--A--M--T--T--L--G--I--D--Y--A--E--P--S--C-
GGAGTTCAAGGCTATCATCTATGGAAATGTGCTGCAGTCCATCCTGGCTATCATCCGGGCCATGACCACACTGGGCATCGATTATGCTGAACCAAGCTGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--><------------------------------------------------------------------------------------------------
-A--D--D--G--R--Q--L--N--N--L--A--D--S--I--E--E--G--T--M--P--P--E--L--V--E--V--I--R--R--L--W--K--D--
GCGGATGACGGGCGACAGCTCAACAACCTGGCTGACTCCATTGAGGAGGGAACCATGCCTCCTGAGCTCGTGGAGGTCATTAGGAGGTTGTGGAAGGATG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------><--------------------------------------
G--G--V--Q--A--C--F--E--R--A--A--E--Y--Q--L--N--D--S--A--S--Y--Y--L--N--Q--L--E--R--I--T--D--P--E--Y
GTGGGGTGCAAGCCTGCTTCGAGAGAGCTGCAGAATACCAGCTTAATGACTCCGCATCTTACTACCTGAACCAATTAGAACGAATTACAGACCCTGAGTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------------------------------------------------><---------
--L--P--S--E--Q--D--V--L--R--S--R--V--K--T--T--G--I--I--E--T--K--F--S--V--K--D--L--N--F--R--M--F--D-
CCTCCCTAGTGAGCAAGATGTGCTCCGATCCAGAGTCAAAACCACGGGCATCATTGAAACCAAGTTTTCCGTCAAAGACTTGAATTTCAGGATGTTTGAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-V--G--G--Q--R--S--E--R--K--K--W--I--H--C--F--E--G--V--T--C--I--I--F--C--A--A--L--S--A--Y--D--M--V--
GTGGGAGGGCAGAGATCCGAGAGAAAGAAGTGGATCCACTGCTTCGAGGGAGTCACCTGCATCATTTTCTGTGCAGCCCTCAGTGCCTATGATATGGTGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------><-------------------------------------------------------------------------------
L--V--E--D--D--E--V--N--R--M--H--E--S--L--H--L--F--N--S--I--C--N--H--K--F--F--A--A--T--S--I--V--L--F
TGGTGGAAGATGACGAAGTGAATCGTATGCATGAGTCTTTGCATCTGTTCAACAGCATATGTAACCACAAATTCTTTGCGGCTACTTCCATTGTCCTCTT
                    ::::::::::::::::: :::::.:::::::::::::: ::.::::::::.:::::::::::::::::::::::::::::
--------------------AATCGTATGCATGAGTCATTGCACCTGTTCAACAGCATTTGCAACCACAAGTTCTTTGCGGCTACTTCCATTGTCCTCTT
---------------------N--R--M--H--E--S--L--H--L--F--N--S--I--C--N--H--K--F--F--A--A--T--S--I--V--L--F

-------------------------------------------------------------------------><-------------------------
--L--N--K--K--D--L--F--E--E--K--I--K--K--V--H--L--S--I--C--F--P--E--Y--D--G--N--N--S--Y--D--D--A--G-
TCTCAACAAGAAGGACCTCTTTGAGGAAAAAATCAAGAAAGTCCATCTCAGCATTTGTTTTCCAGAGTATGATGGTAACAACTCCTATGATGATGCGGGG
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: :::::::::   ::::::::.::::: :::::.:::
TCTCAACAAGAAGGACCTCTTTGAGGAAAAAATCAAGAAAGTCCATCTCAGCATTTGTTTTCCTGAGTATGAT---AACAACTCTTATGAGGATGCAGGG
--L--N--K--K--D--L--F--E--E--K--I--K--K--V--H--L--S--I--C--F--P--E--Y--D-----N--N--S--Y--E--D--A--G-

----------------------------------------------------------------------------------------------------
-N--Y--I--K--S--Q--F--L--D--L--N--M--R--K--D--V--K--E--I--Y--S--H--M--T--C--A--T--D--T--Q--N--V--K--
AATTACATAAAGAGCCAGTTCCTTGACCTCAATATGCGAAAAGATGTCAAAGAAATCTACAGTCACATGACCTGTGCTACAGATACACAGAATGTCAAAT
:::::.:: :::::.:::::::::::::::::.::: :::::::.::::::::::::::.::::::::::::::::::::::::::::::::::::::::
AATTATATCAAGAGTCAGTTCCTTGACCTCAACATGAGAAAAGACGTCAAAGAAATCTATAGTCACATGACCTGTGCTACAGATACACAGAATGTCAAAT
-N--Y--I--K--S--Q--F--L--D--L--N--M--R--K--D--V--K--E--I--Y--S--H--M--T--C--A--T--D--T--Q--N--V--K--

---------------------------------------------------------------->
F--V--F--D--A--V--T--D--I--I--I--K--E--N--L--K--D--C--G--L--F--*-
TTGTGTTTGATGCAGTTACAGATATTATCATCAAAGAAAACCTCAAGGACTGCGGCCTCTTCTAA
::::.::::::::::::::.::::::::::::::::::::::::::::::::.:: :::::::::
TTGTATTTGATGCAGTTACGGATATTATCATCAAAGAAAACCTCAAGGACTGTGGACTCTTCTAA
F--V--F--D--A--V--T--D--I--I--I--K--E--N--L--K--D--C--G--L--F--*-

Pig Consensus Sequence

>BGISUST0000877899
ATGGGGAGTGGAGCCAGTGCTGAGGACAAAGAACTGGCCTAGAGGTCCAAGGAGCTAGAAAAGAAGCTGCAGGAGGATGCTGACAAGGAAGCCAAGACCG
TCAAGCTGCTATTGCTG-----------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------AATCGTATGCATGAGTCATTGCACCTGTTCAACAGCATTTGCAACCACAAGTTCTTTGCGGCTACTTCCATTGTCCTCTT
TCTCAACAAGAAGGACCTCTTTGAGGAAAAAATCAAGAAAGTCCATCTCAGCATTTGTTTTCCTGAGTATGAT---AACAACTCTTATGAGGATGCAGGG
AATTATATCAAGAGTCAGTTCCTTGACCTCAACATGAGAAAAGACGTCAAAGAAATCTATAGTCACATGACCTGTGCTACAGATACACAGAATGTCAAAT
TTGTATTTGATGCAGTTACGGATATTATCATCAAAGAAAACCTCAAGGACTGTGGACTCTTCTAA


>BGISUSP0000877899
MGSGASAEDKELA*RSKELEKKLQEDADKEAKTVKLLLL-------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------NRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKKVHLSICFPEYD-NNSYEDAG
NYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF*