Sequences
EST Library Info
pgl1Pituitary gland
Clusters
Oligos
SNPs

Gene ID ENSG00000171877 (click for geneview)
Transcript ID ENST00000351529(link to ensembl)
Symbol NP_116281.1
Localtion Chromosome:15:41952766:42274544:-1 band: 15q15.3
Description hypothetical protein MGC14161
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--L--S--R--L--M--S--G--S--S--R--S--L--E--R--E--Y--S--C--T--V--R--L--L--D--D--S--E--Y--T--C--T--I--
ATGCTGAGCAGGTTGATGAGCGGCAGCAGCAGGAGCCTGGAGCGCGAGTACAGCTGCACCGTGCGGCTGCTGGACGACAGCGAGTACACCTGCACCATCC
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::
ATGCTGAGCAGGTTGATGAGCGGCAGCAGCAGGAGCCTGGAGCGCGAGTACAGCTGCACCGTGCGGCTACTGGACGACAGCGAGTACACCTGCACCATCC
-M--L--S--R--L--M--S--G--S--S--R--S--L--E--R--E--Y--S--C--T--V--R--L--L--D--D--S--E--Y--T--C--T--I--

-><-------------------------------------------------------------------------------------------------
Q--R--D--A--K--G--Q--Y--L--F--D--L--L--C--H--H--L--N--L--L--E--K--D--Y--F--G--I--R--F--V--D--P--D--K
AGAGAGATGCCAAAGGCCAGTACCTGTTTGACCTTCTTTGCCACCATCTGAACCTACTTGAGAAAGACTATTTTGGTATCCGCTTTGTAGACCCAGATAA
::::::::::::::::::::::::::::::::::::::::::::::.:::::.::::::::::::::::::::::: :::::::::::.::::: :::::
AGAGAGATGCCAAAGGCCAGTACCTGTTTGACCTTCTTTGCCACCACCTGAATCTACTTGAGAAAGACTATTTTGGGATCCGCTTTGTGGACCCTGATAA
Q--R--D--A--K--G--Q--Y--L--F--D--L--L--C--H--H--L--N--L--L--E--K--D--Y--F--G--I--R--F--V--D--P--D--K

------><-----------------------------------------><-------------------------------------------------
--Q--R--H--W--L--E--F--T--K--S--V--V--K--Q--L--R--S--Q--P--P--F--T--M--C--F--R--V--K--F--Y--P--A--D-
GCAGCGGCATTGGCTGGAATTTACAAAGTCTGTGGTGAAACAATTGAGATCCCAGCCTCCATTCACCATGTGCTTCCGTGTGAAGTTTTATCCTGCAGAC
:::::::                                             ::::::::.::::::::::::::::: ::.::::::::.:::::::::
GCAGCGG---------------------------------------------CAGCCTCCGTTCACCATGTGCTTCCGGGTAAAGTTTTACCCTGCAGAC
--Q--R-----------------------------------------------Q--P--P--F--T--M--C--F--R--V--K--F--Y--P--A--D-

----------------------------><----------------------------------------------------------------------
-P--A--A--L--K--E--E--I--T--R--Y--L--V--F--L--Q--I--K--R--D--L--Y--H--G--R--L--L--C--K--T--S--D--A--
CCTGCTGCTCTGAAAGAAGAAATAACCAGGTATTTAGTCTTCCTGCAGATCAAAAGGGATCTCTACCATGGCCGACTCCTCTGTAAAACATCGGATGCTG
::::::::.:: :::::::::::::::   ::::::::::::::::::::::::::::::::::::::.::::: :::::::::::::::::.:::::::
CCTGCTGCCCTCAAAGAAGAAATAACC---TATTTAGTCTTCCTGCAGATCAAAAGGGATCTCTACCACGGCCGCCTCCTCTGTAAAACATCAGATGCTG
-P--A--A--L--K--E--E--I--T-----Y--L--V--F--L--Q--I--K--R--D--L--Y--H--G--R--L--L--C--K--T--S--D--A--

--------------------------><------------------------------------------------------------------------
A--L--L--A--A--Y--I--L--Q--A--E--I--G--D--Y--D--S--G--K--H--P--E--G--Y--S--S--K--F--Q--F--F--P--K--H
CCTTGTTAGCAGCTTACATCCTTCAAGCGGAGATTGGGGATTATGACTCAGGGAAACACCCTGAAGGCTACAGCTCCAAGTTCCAGTTTTTCCCTAAACA
::::::::::::::::.:::::::::   ::::::::::::::::::.::::.:::::::::::::::::::::::::::::::::::::::::::::::
CCTTGTTAGCAGCTTATATCCTTCAA---GAGATTGGGGATTATGACCCAGGAAAACACCCTGAAGGCTACAGCTCCAAGTTCCAGTTTTTCCCTAAACA
A--L--L--A--A--Y--I--L--Q-----E--I--G--D--Y--D--P--G--K--H--P--E--G--Y--S--S--K--F--Q--F--F--P--K--H

--------------------------------------------------><------------------------------------------------
--S--E--K--L--E--R--K--I--A--E--I--H--K--T--E--L--S--G--Q--T--P--A--T--S--E--L--N--F--L--R--K--A--Q-
TTCAGAGAAGCTGGAAAGGAAAATTGCTGAGATTCACAAGACGGAACTGAGTGGTCAAACACCAGCAACATCAGAGCTGAACTTCTTAAGAAAAGCACAG
:::::::::::::::::::::.::::::::::::::::::::.:::      ::::::::::::::::::::::::::::::::.:::::::::::.:::
TTCAGAGAAGCTGGAAAGGAAGATTGCTGAGATTCACAAGACAGAA------GGTCAAACACCAGCAACATCAGAGCTGAACTTTTTAAGAAAAGCGCAG
--S--E--K--L--E--R--K--I--A--E--I--H--K--T--E--------G--Q--T--P--A--T--S--E--L--N--F--L--R--K--A--Q-

--------------------------------------><------------------------------------------------------------
-T--L--E--T--Y--G--V--D--P--H--P--C--K--D--V--S--G--N--A--A--F--L--A--F--T--P--F--G--F--V--V--L--Q--
ACATTGGAAACATATGGAGTGGATCCTCACCCATGTAAGGACGTGTCAGGAAATGCTGCATTTCTGGCCTTCACTCCTTTTGGGTTTGTTGTTCTTCAAG
::::::::.:: :::::::::::.:::::.::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: ::::
ACATTGGAGACCTATGGAGTGGACCCTCATCCGTGTAAGGACGTGTCAGGAAATGCTGCATTTCTGGCCTTCACTCCTTTTGGGTTTGTTGTTCTGCAAG
-T--L--E--T--Y--G--V--D--P--H--P--C--K--D--V--S--G--N--A--A--F--L--A--F--T--P--F--G--F--V--V--L--Q--

---------------------------><--------------------------------------------------------------><-------
G--N--K--R--V--H--F--I--K--W--N--E--V--T--K--L--K--F--E--G--K--T--F--Y--L--Y--V--S--Q--K--E--E--K--K
GAAACAAGAGGGTCCACTTCATTAAATGGAATGAGGTGACCAAGCTGAAATTTGAAGGAAAGACTTTCTATTTATACGTAAGTCAGAAAGAGGAAAAGAA
::::::::::::::::::::::.:::   ::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::   ::::::::
GAAACAAGAGGGTCCACTTCATCAAA---AATGAGGTGACCAAGCTGAAATTTGAAGGAAAGACTTTTTATTTATACGTAAGTCAGAAA---GAAAAGAA
G--N--K--R--V--H--F--I--K-----N--E--V--T--K--L--K--F--E--G--K--T--F--Y--L--Y--V--S--Q--K-----E--K--K

-----------------------------------------------------------------------------------><---------------
--I--I--L--T--Y--F--A--P--T--P--E--A--C--K--H--L--W--K--C--G--I--E--N--Q--A--F--Y--K--L--E--K--S--S-
AATTATTCTTACATATTTTGCTCCAACTCCTGAAGCGTGTAAGCACCTCTGGAAATGTGGAATCGAGAACCAAGCCTTCTACAAGCTGGAGAAGTCAAGC
:::::::::.:::::::::::::::::::: ::::: ::.::::::::::::::::::::.:::::::::::::::::::::   :::::::::::::::
AATTATTCTCACATATTTTGCTCCAACTCCAGAAGCCTGCAAGCACCTCTGGAAATGTGGGATCGAGAACCAAGCCTTCTAC---CTGGAGAAGTCAAGC
--I--I--L--T--Y--F--A--P--T--P--E--A--C--K--H--L--W--K--C--G--I--E--N--Q--A--F--Y-----L--E--K--S--S-

----------------------------------------------------------><----------------------------------------
-Q--V--R--T--V--S--S--S--N--L--F--F--K--G--S--R--F--R--Y--S--G--R--V--A--K--E--V--M--E--S--S--A--K--
CAAGTCCGCACAGTGTCCAGCAGCAATTTATTCTTTAAAGGGAGCCGGTTCCGATACAGTGGCCGAGTTGCAAAGGAAGTCATGGAATCAAGTGCTAAGA
::::::::::::::.::::::::::::::::::::::::::::::::::::::::::   ::::::::::: :::::::: :::::.::.:::::.::::
CAAGTCCGCACAGTATCCAGCAGCAATTTATTCTTTAAAGGGAGCCGGTTCCGATAC---GGCCGAGTTGCCAAGGAAGTAATGGAGTCGAGTGCCAAGA
-Q--V--R--T--V--S--S--S--N--L--F--F--K--G--S--R--F--R--Y-----G--R--V--A--K--E--V--M--E--S--S--A--K--

---------------------------><-----------------------------------------------------------------------
I--K--R--E--P--P--E--I--H--R--A--G--M--V--P--S--R--S--C--P--S--I--T--H--G--P--R--L--S--S--V--P--R--T
TCAAACGGGAGCCACCGGAAATACACAGAGCAGGGATGGTTCCCAGCCGGAGCTGTCCCTCCATAACCCATGGCCCAAGGCTGAGCAGCGTCCCCAGGAC
::::.::.::::::::.:::::::::   :::::::::::::::::::: ::::::::::::::::::::::::::::::::::::::::: ::::::::
TCAAGCGAGAGCCACCAGAAATACAC---GCAGGGATGGTTCCCAGCCGCAGCTGTCCCTCCATAACCCATGGCCCAAGGCTGAGCAGCGTGCCCAGGAC
I--K--R--E--P--P--E--I--H-----A--G--M--V--P--S--R--S--C--P--S--I--T--H--G--P--R--L--S--S--V--P--R--T

----------------------------------><----------------------------------------------------------------
--R--R--R--A--V--H--I--S--I--M--E--G--L--E--S--L--R--D--S--A--H--S--T--P--V--R--S--T--S--H--G--D--T-
CCGCAGAAGAGCTGTTCACATCTCCATCATGGAAGGCCTAGAGTCCTTACGGGACAGTGCCCATTCCACACCAGTGCGTTCCACTTCCCATGGGGACACC
::: ::::::::::::::::::::::::::::::   :: ::::::.:.::::::::::::::.::::: ::.::.:::::: :::::::.:::::::::
CCGGAGAAGAGCTGTTCACATCTCCATCATGGAA---CTCGAGTCCCTGCGGGACAGTGCCCACTCCACCCCGGTACGTTCCTCTTCCCACGGGGACACC
--R--R--R--A--V--H--I--S--I--M--E-----L--E--S--L--R--D--S--A--H--S--T--P--V--R--S--S--S--H--G--D--T-

----------------------------------------------------------------------------------------------------
-F--L--P--H--V--R--S--S--R--T--D--S--N--E--R--V--A--V--I--A--D--E--A--Y--S--P--A--D--S--V--L--P--T--
TTCCTGCCTCACGTGAGAAGCAGCCGGACAGATAGCAATGAGCGAGTAGCTGTGATTGCAGACGAGGCCTACAGCCCTGCAGACAGCGTGCTGCCCACCC
:::::::::::::::::::::::::::.::::.:::::.:::::::: .: :: ::.:::::.:::::::::::::::::::::::.:::::::::::::
TTCCTGCCTCACGTGAGAAGCAGCCGGGCAGACAGCAACGAGCGAGTCACGGTCATCGCAGATGAGGCCTACAGCCCTGCAGACAGTGTGCTGCCCACCC
-F--L--P--H--V--R--S--S--R--A--D--S--N--E--R--V--T--V--I--A--D--E--A--Y--S--P--A--D--S--V--L--P--T--

----------------------------------------------------------------------------------------------------
P--V--A--E--H--S--L--E--L--M--L--L--S--R--Q--I--N--G--A--T--C--S--I--E--E--E--K--E--S--E--A--S--T--P
CTGTGGCTGAGCACAGCCTGGAGCTGATGTTGCTTTCCCGGCAGATCAATGGAGCCACCTGCAGCATTGAGGAGGAGAAGGAATCTGAAGCCAGCACCCC
:::::::.:::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::.::::::::.:::::::::::
CTGTGGCCGAGCACAGCCTGGAGCTGATGCTGCTTTCCCGGCAGATCAATGGAGCCACCTGCAGCATTGAGGAGGAGAAAGAATCTGAGGCCAGCACCCC
P--V--A--E--H--S--L--E--L--M--L--L--S--R--Q--I--N--G--A--T--C--S--I--E--E--E--K--E--S--E--A--S--T--P

----------------------------------------------------------------------------------------------------
--T--A--T--E--V--E--A--L--G--G--E--L--R--A--L--C--Q--G--H--S--G--P--E--E--E--Q--V--N--K--F--V--L--S-
AACTGCTACAGAGGTGGAGGCCCTTGGGGGAGAGCTGAGGGCCCTGTGTCAGGGGCACAGCGGGCCCGAGGAGGAACAGGTGAATAAGTTTGTTCTAAGT
:::::::.:::::.::::::::::::::::::::::::::::::::::::::::::::.::.:::: :::::::::::::::::::::::::::.:::::
AACTGCTGCAGAGATGGAGGCCCTTGGGGGAGAGCTGAGGGCCCTGTGTCAGGGGCACGGCAGGCCAGAGGAGGAACAGGTGAATAAGTTTGTTTTAAGT
--T--A--A--E--M--E--A--L--G--G--E--L--R--A--L--C--Q--G--H--G--R--P--E--E--E--Q--V--N--K--F--V--L--S-

----------------------------------------------------------------------------------------------------
-V--L--R--L--L--L--V--T--M--G--L--L--F--V--L--L--L--L--L--I--I--L--T--E--S--D--L--D--I--A--F--F--R--
GTCCTCCGTTTGCTCCTTGTGACCATGGGACTCCTCTTTGTTTTGCTCCTCCTCCTGATCATCCTTACCGAGTCTGACCTTGACATTGCCTTTTTCCGTG
::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::.:
GTCCTCCGTTTGCTTCTTGTGACCATGGGACTCCTCTTTGTTTTGCTCCTCCTCCTGATCATCCTTACTGAGTCTGACCTTGACATTGCCTTTTTCCGCG
-V--L--R--L--L--L--V--T--M--G--L--L--F--V--L--L--L--L--L--I--I--L--T--E--S--D--L--D--I--A--F--F--R--

----------------------------------------------------------------------------------------------------
D--I--R--Q--T--P--E--F--E--Q--F--H--Y--Q--Y--F--C--P--L--R--R--W--F--A--C--K--I--R--S--V--V--S--L--L
ATATCCGCCAGACCCCCGAGTTTGAACAATTCCACTATCAATACTTTTGTCCCCTCAGGCGATGGTTTGCCTGCAAAATCCGCTCAGTGGTGAGCCTGCT
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::
ATATCCGCCAGACCCCCGAGTTTGAACAATTCCACTATCAATACTTTTGTCCCCTCAGGCGATGGTTTGCCTGCAAAGTCCGCTCAGTGGTGAGCCTGCT
D--I--R--Q--T--P--E--F--E--Q--F--H--Y--Q--Y--F--C--P--L--R--R--W--F--A--C--K--V--R--S--V--V--S--L--L

------------>
--I--D--T--*-
CATTGACACCTGA
:::::::::::::
CATTGACACCTGA
--I--D--T--*-

Pig Consensus Sequence

>BGISUST0000900275
ATGCTGAGCAGGTTGATGAGCGGCAGCAGCAGGAGCCTGGAGCGCGAGTACAGCTGCACCGTGCGGCTACTGGACGACAGCGAGTACACCTGCACCATCC
AGAGAGATGCCAAAGGCCAGTACCTGTTTGACCTTCTTTGCCACCACCTGAATCTACTTGAGAAAGACTATTTTGGGATCCGCTTTGTGGACCCTGATAA
GCAGCGG---------------------------------------------CAGCCTCCGTTCACCATGTGCTTCCGGGTAAAGTTTTACCCTGCAGAC
CCTGCTGCCCTCAAAGAAGAAATAACC---TATTTAGTCTTCCTGCAGATCAAAAGGGATCTCTACCACGGCCGCCTCCTCTGTAAAACATCAGATGCTG
CCTTGTTAGCAGCTTATATCCTTCAA---GAGATTGGGGATTATGACCCAGGAAAACACCCTGAAGGCTACAGCTCCAAGTTCCAGTTTTTCCCTAAACA
TTCAGAGAAGCTGGAAAGGAAGATTGCTGAGATTCACAAGACAGAA------GGTCAAACACCAGCAACATCAGAGCTGAACTTTTTAAGAAAAGCGCAG
ACATTGGAGACCTATGGAGTGGACCCTCATCCGTGTAAGGACGTGTCAGGAAATGCTGCATTTCTGGCCTTCACTCCTTTTGGGTTTGTTGTTCTGCAAG
GAAACAAGAGGGTCCACTTCATCAAA---AATGAGGTGACCAAGCTGAAATTTGAAGGAAAGACTTTTTATTTATACGTAAGTCAGAAA---GAAAAGAA
AATTATTCTCACATATTTTGCTCCAACTCCAGAAGCCTGCAAGCACCTCTGGAAATGTGGGATCGAGAACCAAGCCTTCTAC---CTGGAGAAGTCAAGC
CAAGTCCGCACAGTATCCAGCAGCAATTTATTCTTTAAAGGGAGCCGGTTCCGATAC---GGCCGAGTTGCCAAGGAAGTAATGGAGTCGAGTGCCAAGA
TCAAGCGAGAGCCACCAGAAATACAC---GCAGGGATGGTTCCCAGCCGCAGCTGTCCCTCCATAACCCATGGCCCAAGGCTGAGCAGCGTGCCCAGGAC
CCGGAGAAGAGCTGTTCACATCTCCATCATGGAA---CTCGAGTCCCTGCGGGACAGTGCCCACTCCACCCCGGTACGTTCCTCTTCCCACGGGGACACC
TTCCTGCCTCACGTGAGAAGCAGCCGGGCAGACAGCAACGAGCGAGTCACGGTCATCGCAGATGAGGCCTACAGCCCTGCAGACAGTGTGCTGCCCACCC
CTGTGGCCGAGCACAGCCTGGAGCTGATGCTGCTTTCCCGGCAGATCAATGGAGCCACCTGCAGCATTGAGGAGGAGAAAGAATCTGAGGCCAGCACCCC
AACTGCTGCAGAGATGGAGGCCCTTGGGGGAGAGCTGAGGGCCCTGTGTCAGGGGCACGGCAGGCCAGAGGAGGAACAGGTGAATAAGTTTGTTTTAAGT
GTCCTCCGTTTGCTTCTTGTGACCATGGGACTCCTCTTTGTTTTGCTCCTCCTCCTGATCATCCTTACTGAGTCTGACCTTGACATTGCCTTTTTCCGCG
ATATCCGCCAGACCCCCGAGTTTGAACAATTCCACTATCAATACTTTTGTCCCCTCAGGCGATGGTTTGCCTGCAAAGTCCGCTCAGTGGTGAGCCTGCT
CATTGACACCTGA


>BGISUSP0000900275
MLSRLMSGSSRSLEREYSCTVRLLDDSEYTCTIQRDAKGQYLFDLLCHHLNLLEKDYFGIRFVDPDKQR---------------QPPFTMCFRVKFYPAD
PAALKEEIT-YLVFLQIKRDLYHGRLLCKTSDAALLAAYILQ-EIGDYDPGKHPEGYSSKFQFFPKHSEKLERKIAEIHKTE--GQTPATSELNFLRKAQ
TLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHFIK-NEVTKLKFEGKTFYLYVSQK-EKKIILTYFAPTPEACKHLWKCGIENQAFY-LEKSS
QVRTVSSSNLFFKGSRFRY-GRVAKEVMESSAKIKREPPEIH-AGMVPSRSCPSITHGPRLSSVPRTRRRAVHISIME-LESLRDSAHSTPVRSSSHGDT
FLPHVRSSRADSNERVTVIADEAYSPADSVLPTPVAEHSLELMLLSRQINGATCSIEEEKESEASTPTAAEMEALGGELRALCQGHGRPEEEQVNKFVLS
VLRLLLVTMGLLFVLLLLLIILTESDLDIAFFRDIRQTPEFEQFHYQYFCPLRRWFACKVRSVVSLLIDT*