Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000169220 (click for geneview)
Transcript ID ENST00000351955(link to ensembl)
Symbol NP_006471.2
Localtion Chromosome:5:176717480:176732203:1 band: 5q35.3
Description regulator of G-protein signalling 14
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------------------><--------------------><--------------------------------
-M--P--G--K--P--K--H--L--G--V--P--N--G--R--M--V--L--A--V--S--D--G--E--L--S--S--T--T--G--P--Q--G--Q--
ATGCCAGGGAAGCCCAAGCACCTGGGCGTCCCCAACGGGCGCATGGTTCTGGCTGTGTCAGATGGAGAGCTGAGCAGCACGACGGGGCCCCAGGGCCAGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
G--E--G--R--G--S--S--L--S--I--H--S--L--P--S--G--P--S--S--P--F--P--T--E--E--Q--P--V--A--S--W--A--L--S
GCGAGGGCCGCGGCAGCTCTCTCAGCATCCACAGCCTCCCCAGTGGTCCCAGCAGCCCCTTCCCAACCGAGGAGCAGCCTGTGGCCAGCTGGGCCCTGTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------><-----------------------------------------------------
--F--E--R--L--L--Q--D--P--L--G--L--A--Y--F--T--E--F--L--K--K--E--F--S--A--E--N--V--T--F--W--K--A--C-
CTTCGAGCGGCTGTTGCAGGACCCGCTGGGCCTGGCTTACTTCACTGAGTTCCTGAAGAAGGAGTTCAGCGCGGAAAACGTGACTTTCTGGAAGGCCTGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------><------------------------------------------------------------
-E--R--F--Q--Q--I--P--A--S--D--T--Q--Q--L--A--Q--E--A--R--N--I--Y--Q--E--F--L--S--S--Q--A--L--S--P--
GAGCGCTTCCAGCAGATCCCGGCCAGCGATACCCAGCAGCTAGCTCAGGAGGCCCGCAACATCTACCAGGAGTTCCTGTCCAGCCAGGCGCTGAGCCCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------><----------------
V--N--I--D--R--Q--A--W--L--G--E--E--V--L--A--E--P--R--P--D--M--F--R--A--Q--Q--L--Q--I--F--N--L--M--K
TGAACATCGACCGTCAGGCCTGGCTTGGCGAGGAGGTGCTGGCCGAGCCCCGGCCGGACATGTTTCGGGCACAGCAGCTTCAGATCTTCAACTTGATGAA
                                                                                   :::::::::::::::::
-----------------------------------------------------------------------------------ATCTTCAACTTGATGAA
------------------------------------------------------------------------------------I--F--N--L--M--K

----------------------------------------------------------------------------------------------------
--F--D--S--Y--A--R--F--V--K--S--P--L--Y--R--E--C--L--L--A--E--A--E--G--R--P--L--R--E--P--G--S--S--R-
GTTCGACAGCTATGCGCGCTTCGTCAAGTCCCCGCTGTACCGCGAGTGCCTGCTAGCCGAAGCCGAGGGACGCCCTCTGCGGGAACCTGGCTCCTCGCGC
:::::::::::::::::::::::::::.:::::: :::::::::::::::: ::::: ::.:::::::: :::::.:::::::::::::: :::::::::
GTTCGACAGCTATGCGCGCTTCGTCAAATCCCCGATGTACCGCGAGTGCCTCCTAGCGGAGGCCGAGGGTCGCCCCCTGCGGGAACCTGGATCCTCGCGC
--F--D--S--Y--A--R--F--V--K--S--P--M--Y--R--E--C--L--L--A--E--A--E--G--R--P--L--R--E--P--G--S--S--R-

--------------------------><------------------------------------------------------------------------
-L--G--S--P--D--A--T--R--K--K--P--K--L--K--P--G--K--S--L--P--L--G--V--E--E--L--G--Q--L--P--P--V--E--
CTCGGCAGCCCTGACGCCACGAGGAAGAAGCCGAAGCTGAAGCCCGGGAAGTCGCTGCCGCTGGGTGTGGAGGAGTTGGGGCAGCTGCCACCCGTTGAGG
:::::::::::::: :::::.::::::::.:  :::::::::::.:::::::::::::::::::::::::::::::::::::::: :::.:  :.:::::
CTCGGCAGCCCTGAAGCCACAAGGAAGAAACATAAGCTGAAGCCTGGGAAGTCGCTGCCGCTGGGTGTGGAGGAGTTGGGGCAGCAGCCGCAGGCTGAGG
-L--G--S--P--E--A--T--R--K--K--H--K--L--K--P--G--K--S--L--P--L--G--V--E--E--L--G--Q--Q--P--Q--A--E--

--------------------------------------><------------------------------------------------------------
G--P--G--G--R--P--L--R--K--S--F--R--R--E--L--G--G--T--A--N--A--A--L--R--R--E--S--Q--G--S--L--N--S--S
GTCCTGGGGGCCGCCCTCTCCGCAAGTCCTTCCGCCGGGAGCTGGGCGGGACTGCAAACGCCGCCTTGCGCCGAGAGTCTCAGGGCTCCCTCAACTCCTC
:.:::::::::::::::::::::::::::::::::                                                                 
GCCCTGGGGGCCGCCCTCTCCGCAAGTCCTTCCGC-----------------------------------------------------------------
G--P--G--G--R--P--L--R--K--S--F--R------------------------------------------------------------------

------------------------------------------------><--------------------------------------------------
--A--S--L--D--L--G--F--L--A--F--V--S--S--K--S--E--S--H--R--K--S--L--G--S--T--E--G--E--S--E--S--R--P-
CGCCAGCCTGGACCTTGGCTTCCTAGCCTTCGTCAGCAGCAAATCTGAGAGCCACCGGAAGAGCCTTGGGAGCACGGAGGGTGAAAGTGAAAGCCGGCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--K--Y--C--C--V--Y--L--P--D--G--T--A--S--L--A--L--A--R--P--G--L--T--I--R--D--M--L--A--G--I--C--E--
GGGAAGTACTGCTGTGTGTACCTGCCCGATGGCACAGCCTCCTTGGCCCTGGCCAGACCTGGCCTCACCATCCGAGACATGCTGGCAGGGATCTGTGAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------><----------------------------------------------
K--R--G--L--S--L--P--D--I--K--V--Y--L--V--G--N--E--Q--A--L--V--L--D--Q--D--C--T--V--L--A--D--Q--E--V
AACGAGGCCTCTCTCTACCTGACATCAAGGTCTACCTGGTGGGCAATGAACAGGCCCTGGTCCTGGATCAGGACTGCACCGTGCTGGCGGATCAGGAAGT
                                                     :::::::::.::::::::::::::::::::::::::::.::::::::
-----------------------------------------------------GCCCTGGTCTTGGATCAGGACTGCACCGTGCTGGCGGACCAGGAAGT
------------------------------------------------------A--L--V--L--D--Q--D--C--T--V--L--A--D--Q--E--V

--------------------------><------------------------------------------------------------------------
--R--L--E--N--R--I--T--F--E--L--E--L--T--A--L--E--R--V--V--R--I--S--A--K--P--T--K--R--L--Q--E--A--L-
GCGGCTGGAAAACAGGATCACCTTCGAGCTGGAGCTGACGGCGCTGGAGCGCGTGGTACGAATCTCAGCCAAGCCCACCAAGCGGCTGCAGGAGGCGCTG
:::.:::::.:::::::::::::::   ::::::.::.:::::::::::::::::::.::.::::: :::::::::::::::::::::::::: ::::::
GCGACTGGAGAACAGGATCACCTTC---CTGGAGTTGGCGGCGCTGGAGCGCGTGGTGCGGATCTCCGCCAAGCCCACCAAGCGGCTGCAGGACGCGCTG
--R--L--E--N--R--I--T--F-----L--E--L--A--A--L--E--R--V--V--R--I--S--A--K--P--T--K--R--L--Q--D--A--L-

-----------------------------------------------------><---------------------------------------------
-Q--P--I--L--E--K--H--G--L--S--P--L--E--V--V--L--H--R--P--G--E--K--Q--P--L--D--L--G--K--L--V--S--S--
CAGCCCATTCTGGAGAAGCACGGCTTGAGCCCGCTAGAGGTGGTGCTGCACCGGCCAGGCGAGAAACAGCCTCTGGATCTGGGGAAGCTAGTGAGCTCGG
::::::::.:::: ::::::.:::.: ::::::: : ::::::.::::      :::::.:::::.::::: ::::::::.::::::::.:::::::: :
CAGCCCATCCTGGCGAAGCATGGCCTCAGCCCGCAACAGGTGGCGCTG------CCAGGTGAGAAGCAGCCGCTGGATCTAGGGAAGCTGGTGAGCTCCG
-Q--P--I--L--A--K--H--G--L--S--P--Q--Q--V--A--L--------P--G--E--K--Q--P--L--D--L--G--K--L--V--S--S--

-----------------------------------><---------------------------------------------><----------------
V--A--A--Q--R--L--V--L--D--T--L--P--G--V--K--I--S--K--A--R--D--K--S--P--C--R--S--Q--G--C--P--P--R--T
TGGCGGCCCAGAGACTGGTTTTGGACACTCTTCCAGGTGTGAAGATCTCCAAAGCCCGTGACAAATCTCCCTGCCGCAGCCAGGGCTGCCCACCTAGAAC
::::::::::::::::::: :::::::::::.:::                                                                 
TGGCGGCCCAGAGACTGGTGTTGGACACTCTCCCA-----------------------------------------------------------------
V--A--A--Q--R--L--V--L--D--T--L--P------------------------------------------------------------------

-------------------------------------------------------------------------------------------------><-
--Q--D--K--A--T--H--P--P--P--A--S--P--S--S--L--V--K--V--P--S--S--A--T--G--K--R--Q--T--C--D--I--E--G-
TCAGGATAAGGCCACCCATCCCCCTCCAGCGTCCCCCAGTTCTCTGGTGAAGGTGCCCAGTAGTGCCACTGGAAAGCGGCAGACCTGTGACATCGAAGGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--V--E--L--L--N--R--V--Q--S--S--G--A--H--D--Q--R--G--L--L--R--K--E--D--L--V--L--P--E--F--L--Q--L--
CTGGTGGAGCTGCTGAACCGGGTGCAGAGCAGCGGGGCCCACGACCAGAGGGGCCTTCTGAGGAAAGAGGACCTGGTACTTCCAGAATTTCTGCAGCTGC
::::::::::::.::::::::::::::::::::::.:::::.::.::::::::::::::: : ::::::::::::::.::::::::::::::::::::::
CTGGTGGAGCTGTTGAACCGGGTGCAGAGCAGCGGAGCCCATGATCAGAGGGGCCTTCTGCGCAAAGAGGACCTGGTGCTTCCAGAATTTCTGCAGCTGC
-L--V--E--L--L--N--R--V--Q--S--S--G--A--H--D--Q--R--G--L--L--R--K--E--D--L--V--L--P--E--F--L--Q--L--

----------------------><----------------------------------------------------------------------------
P--A--Q--G--P--S--S--E--P--T--T--D--Q--I--S--S--P--A--H--R--G--I--L--E--L--H--H--R--L--S--P--L--T--A
CCGCCCAAGGGCCCAGCTCCGAGCCCACCACAGACCAAATCAGCAGCCCAGCCCATCGGGGGATCCTTGAACTCCACCACCGACTCAGCCCTCTGACAGC
:.:.::::::.  .:.:::: :::::: :::::::..:::::::.::::::::.:  ::::  .:::...:::::::..:: ::::::::::::::::::
CTGTCCAAGGAAATAACTCCCAGCCCAGCACAGACTGAATCAGCGGCCCAGCCTAAGGGGGCCCCCTCAGACTCCACTGCCCACTCAGCCCTCTGACAGC
P--V--Q--G--N--N--S--Q--P--S--T--D--*--I--S--G--P--A--*--G--G--P--L--R--L--H--C--P--L--S--P--L--T--A

------------------------------------------------------------------------------------>
--T--Q--Q--S--R--T--A--A--W--H--P--A--G--R--A--C--H--G--S--A--L--H--A--L--S--V--P--*-
TACCCAACAGTCCAGGACAGCTGCATGGCACCCGGCGGGCCGAGCATGCCATGGGTCCGCTCTGCATGCCCTGTCTGTGCCATGA
:.::::. ::::::.: ::::::::::::::                                                      
TGCCCAGAAGTCCAAGCCAGCTGCATGGCAC------------------------------------------------------
--A--Q--K--S--K--P--A--A--W--H-------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000901932
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------------------------------------------------------------------------ATCTTCAACTTGATGAA
GTTCGACAGCTATGCGCGCTTCGTCAAATCCCCGATGTACCGCGAGTGCCTCCTAGCGGAGGCCGAGGGTCGCCCCCTGCGGGAACCTGGATCCTCGCGC
CTCGGCAGCCCTGAAGCCACAAGGAAGAAACATAAGCTGAAGCCTGGGAAGTCGCTGCCGCTGGGTGTGGAGGAGTTGGGGCAGCAGCCGCAGGCTGAGG
GCCCTGGGGGCCGCCCTCTCCGCAAGTCCTTCCGC-----------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------------------------------------------GCCCTGGTCTTGGATCAGGACTGCACCGTGCTGGCGGACCAGGAAGT
GCGACTGGAGAACAGGATCACCTTC---CTGGAGTTGGCGGCGCTGGAGCGCGTGGTGCGGATCTCCGCCAAGCCCACCAAGCGGCTGCAGGACGCGCTG
CAGCCCATCCTGGCGAAGCATGGCCTCAGCCCGCAACAGGTGGCGCTG------CCAGGTGAGAAGCAGCCGCTGGATCTAGGGAAGCTGGTGAGCTCCG
TGGCGGCCCAGAGACTGGTGTTGGACACTCTCCCA-----------------------------------------------------------------
----------------------------------------------------------------------------------------------------
CTGGTGGAGCTGTTGAACCGGGTGCAGAGCAGCGGAGCCCATGATCAGAGGGGCCTTCTGCGCAAAGAGGACCTGGTGCTTCCAGAATTTCTGCAGCTGC
CTGTCCAAGGAAATAACTCCCAGCCCAGCACAGACTGAATCAGCGGCCCAGCCTAAGGGGGCCCCCTCAGACTCCACTGCCCACTCAGCCCTCTGACAGC
TGCCCAGAAGTCCAAGCCAGCTGCATGGCAC------------------------------------------------------


>BGISUSP0000901932
----------------------------------------------------------------------------------------------------
-------------------------------------------------------------IFNLMKFDSYARFVKSPMYRECLLAEAEGRPLREPGSSR
LGSPEATRKKHKLKPGKSLPLGVEELGQQPQAEGPGGRPLRKSFR-------------------------------------------------------
---------------------------------------------------ALVLDQDCTVLADQEVRLENRITF-LELAALERVVRISAKPTKRLQDAL
QPILAKHGLSPQQVAL--PGEKQPLDLGKLVSSVAAQRLVLDTLP-------------------------------------------------------
LVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQLPVQGNNSQPSTD*ISGPA*GGPLRLHCPLSPLTAAQKSKPAAWH------------------