Sequences
EST Library Info
ebs1Foetus 50 days, brain stem
mcp1Mammae, collostrum producing
nje1Newborn 115 days, jejunum
pigcb1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000185324 (click for geneview)
Transcript ID ENST00000353379(link to ensembl)
Symbol CDK10
Localtion Chromosome:16:88280579:88290257:1 band: 16q24.3
Description cyclin-dependent kinase 10 isoform 1
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------------------------------------------------------------><------------
-M--A--E--P--D--L--E--C--E--Q--I--R--L--K--C--I--R--K--E--G--F--F--T--V--P--P--E--H--R--L--G--R--C--
ATGGCGGAGCCAGATCTGGAGTGCGAGCAGATCCGTCTGAAGTGTATTCGTAAGGAGGGCTTCTTCACGGTGCCTCCGGAACACAGGCTGGGACGATGCC
::::  :::::.:: :. ::::  ::::::::.::::::::::::::.::::::::.:::::::::::::::::::::::.::::::            :
ATGGGCGAGCCGGAGCCCGAGTCGGAGCAGATTCGTCTGAAGTGTATCCGTAAGGAAGGCTTCTTCACGGTGCCTCCGGAGCACAGG------------C
-M--G--E--P--E--P--E--S--E--Q--I--R--L--K--C--I--R--K--E--G--F--F--T--V--P--P--E--H--R--------------

-----------------------------------------------------------><---------------------------------------
R--S--V--K--E--F--E--K--L--N--R--I--G--E--G--T--Y--G--I--V--Y--R--A--R--D--T--Q--T--D--E--I--V--A--L
GGAGTGTGAAGGAGTTTGAGAAGCTGAACCGCATTGGAGAGGGTACCTACGGCATTGTGTATCGGGCCCGGGACACCCAGACAGATGAGATTGTCGCACT
::::.:::::::::::::::::::: ::.:::::.::.::.::.:::::::::::.:::   :: :::::::::::::::::.::.::::::::.:: ::
GGAGCGTGAAGGAGTTTGAGAAGCTCAATCGCATCGGGGAAGGCACCTACGGCATCGTG---CGTGCCCGGGACACCCAGACGGACGAGATTGTTGCCCT
R--S--V--K--E--F--E--K--L--N--R--I--G--E--G--T--Y--G--I--V-----R--A--R--D--T--Q--T--D--E--I--V--A--L

-------------------------------><-------------------------------------------------------------------
--K--K--V--R--M--D--K--E--K--D--G--I--P--I--S--S--L--R--E--I--T--L--L--L--R--L--R--H--P--N--I--V--E-
GAAGAAGGTGCGGATGGACAAGGAGAAGGATGGCATCCCCATCAGCAGCTTGCGGGAGATCACGCTGCTGCTCCGCCTGCGTCATCCGAACATCGTGGAG
::::::.:::::::::::::::::::::      .::::::::::::::.: ::.:::::::::::::: ::.::::: ::.::::::::::::::::::
GAAGAAAGTGCGGATGGACAAGGAGAAG------GTCCCCATCAGCAGCCTTCGAGAGATCACGCTGCTCCTTCGCCTCCGCCATCCGAACATCGTGGAG
--K--K--V--R--M--D--K--E--K--------V--P--I--S--S--L--R--E--I--T--L--L--L--R--L--R--H--P--N--I--V--E-

----------------------------------><----------------------------------------------------------------
-L--K--E--V--V--V--G--N--H--L--E--S--I--F--L--V--M--G--Y--C--E--Q--D--L--A--S--L--L--E--N--M--P--T--
CTGAAGGAGGTGGTTGTGGGGAACCACCTGGAGAGCATCTTCCTGGTGATGGGTTACTGTGAGCAGGACCTGGCCAGCCTCCTGGAGAATATGCCAACAC
:::::::::::::::::::::::::::::::::   :::::::::::::::::::::::::::::.::::::::::::::.::::::::.:::::.:: :
CTGAAGGAGGTGGTTGTGGGGAACCACCTGGAG---ATCTTCCTGGTGATGGGTTACTGTGAGCAAGACCTGGCCAGCCTTCTGGAGAACATGCCGACCC
-L--K--E--V--V--V--G--N--H--L--E-----I--F--L--V--M--G--Y--C--E--Q--D--L--A--S--L--L--E--N--M--P--T--

----------------><------------------------------------------------------------------><--------------
P--F--S--E--A--Q--V--K--C--I--V--L--Q--V--L--R--G--L--Q--Y--L--H--R--N--F--I--I--H--R--D--L--K--V--S
CCTTCTCGGAGGCTCAGGTCAAGTGCATCGTGCTGCAGGTGCTCCGGGGCCTCCAGTATCTGCACAGGAACTTCATTATCCACAGGGACCTGAAGGTTTC
::::::: :::::.::::::::::::::.:::::::::::::::::::::::::::::::::::: .:::::::::.::::::                 
CCTTCTCTGAGGCCCAGGTCAAGTGCATTGTGCTGCAGGTGCTCCGGGGCCTCCAGTATCTGCACCAGAACTTCATCATCCAC-----------------
P--F--S--E--A--Q--V--K--C--I--V--L--Q--V--L--R--G--L--Q--Y--L--H--Q--N--F--I--I--H------------------

-------------------------------------><-------------------------------------------------------------
--N--L--L--M--T--D--K--G--C--V--K--T--A--D--F--G--L--A--R--A--Y--G--V--P--V--K--P--M--T--P--K--V--V-
CAACTTGCTCATGACCGACAAGGGTTGTGTGAAGACAGCGGATTTCGGCCTGGCCCGGGCCTATGGTGTCCCAGTAAAGCCAATGACCCCCAAGGTGGTC
                                                 ::::::::::::::.::... :::::.::::: ::::::::::::::::::
-------------------------------------------------CTGGCCCGGGCCTACGGCACGCCAGTGAAGCCCATGACCCCCAAGGTGGTC
--------------------------------------------------L--A--R--A--Y--G--T--P--V--K--P--M--T--P--K--V--V-

-------><----------------------------------------------------------><-------------------------------
-T--L--W--Y--R--A--P--E--L--L--L--G--T--T--T--Q--T--T--S--I--D--M--W--A--V--G--C--I--L--A--E--L--L--
ACTCTCTGGTACCGAGCCCCTGAACTGCTGTTGGGAACCACCACGCAGACCACCAGCATCGACATGTGGGCTGTGGGCTGCATACTGGCCGAGCTGCTGG
::.:::   :::::::::::.:::::::::.:::::: :::::.::::::  ::::::::::::::   :: ::::::::::: ::::::::::::::::
ACCCTC---TACCGAGCCCCCGAACTGCTGCTGGGAAGCACCATGCAGACGCCCAGCATCGACATG---GCAGTGGGCTGCATCCTGGCCGAGCTGCTGG
-T--L-----Y--R--A--P--E--L--L--L--G--S--T--M--Q--T--P--S--I--D--M-----A--V--G--C--I--L--A--E--L--L--

-------------------------------------------------------------------------------------------><-------
A--H--R--P--L--L--P--G--T--S--E--I--H--Q--I--D--L--I--V--Q--L--L--G--T--P--S--E--N--I--W--P--G--F--S
CGCACAGGCCTCTTCTCCCCGGCACTTCCGAGATCCACCAGATCGACTTGATCGTGCAGCTGCTGGGCACGCCCAGTGAGAACATCTGGCCGGGCTTTTC
: ::::.:::.::.:::::.::::::::.::::::::::::.: :::.::::::::::::::::::: :: :::::.::::::::::::::::::::.::
CCCACAAGCCCCTCCTCCCTGGCACTTCTGAGATCCACCAGGTGGACCTGATCGTGCAGCTGCTGGGGACCCCCAGCGAGAACATCTGGCCGGGCTTCTC
A--H--K--P--L--L--P--G--T--S--E--I--H--Q--V--D--L--I--V--Q--L--L--G--T--P--S--E--N--I--W--P--G--F--S

----------------------------------------------------------------------------------------------------
--K--L--P--L--V--G--Q--Y--S--L--R--K--Q--P--Y--N--N--L--K--H--K--F--P--W--L--S--E--A--G--L--R--L--L-
CAAGCTGCCACTGGTCGGCCAGTACAGCCTCCGGAAGCAGCCCTACAACAACCTGAAGCACAAGTTCCCATGGCTGTCGGAGGCCGGGCTGCGCCTGCTG
: :::::::.:::::::::::::::::::: ::::::::::: ::::::::::: ::::::::::::::.::::: ::::::::.:: ::::::::::::
CCAGCTGCCGCTGGTCGGCCAGTACAGCCTGCGGAAGCAGCCGTACAACAACCTCAAGCACAAGTTCCCGTGGCTCTCGGAGGCTGGCCTGCGCCTGCTG
--Q--L--P--L--V--G--Q--Y--S--L--R--K--Q--P--Y--N--N--L--K--H--K--F--P--W--L--S--E--A--G--L--R--L--L-

-------------------------------><---------------------------------------------------><--------------
-H--F--L--F--M--Y--D--P--K--K--R--A--T--A--G--D--C--L--E--S--S--Y--F--K--E--K--P--L--P--C--E--P--E--
CACTTCCTGTTCATGTACGACCCTAAGAAAAGGGCGACGGCCGGGGACTGCCTGGAGAGCTCCTATTTCAAGGAGAAGCCCCTACCCTGTGAGCCGGAGC
 ::.:::: ::::::::::::::.::::::   ::::::::::: ::::::::::::::::::::.::::::::::::::.      ::.::::::::::
AACCTCCTCTTCATGTACGACCCCAAGAAA---GCGACGGCCGGCGACTGCCTGGAGAGCTCCTACTTCAAGGAGAAGCCT------TGCGAGCCGGAGC
-N--L--L--F--M--Y--D--P--K--K-----A--T--A--G--D--C--L--E--S--S--Y--F--K--E--K--P--------C--E--P--E--

------------------------------------------------------------------------------------->
L--M--P--T--F--P--H-----H--R--N--K--R--A--A--P--A--T--S--E--G--Q--S--K--R--C--K--P--*-
TCATGCCGACCTTTCCCCAC---CACCGCAACAAGCGGGCCGCCCCAGCCACCTCCGAGGGCCAGAGCAAGCGCTGTAAACCCTGA
::::::: ::.::.::::::   ::.::::::::::  :::                                             
TCATGCCCACTTTCCCCCACC--CATCGCAACAAGCCTGCC---------------------------------------------
L--M--P--T--F--P--H--\--H--R--N--K--P--A----------------------------------------------

Pig Consensus Sequence

>BGISUST0000896165
ATGGGCGAGCCGGAGCCCGAGTCGGAGCAGATTCGTCTGAAGTGTATCCGTAAGGAAGGCTTCTTCACGGTGCCTCCGGAGCACAGG------------C
GGAGCGTGAAGGAGTTTGAGAAGCTCAATCGCATCGGGGAAGGCACCTACGGCATCGTG---CGTGCCCGGGACACCCAGACGGACGAGATTGTTGCCCT
GAAGAAAGTGCGGATGGACAAGGAGAAG------GTCCCCATCAGCAGCCTTCGAGAGATCACGCTGCTCCTTCGCCTCCGCCATCCGAACATCGTGGAG
CTGAAGGAGGTGGTTGTGGGGAACCACCTGGAG---ATCTTCCTGGTGATGGGTTACTGTGAGCAAGACCTGGCCAGCCTTCTGGAGAACATGCCGACCC
CCTTCTCTGAGGCCCAGGTCAAGTGCATTGTGCTGCAGGTGCTCCGGGGCCTCCAGTATCTGCACCAGAACTTCATCATCCAC-----------------
-------------------------------------------------CTGGCCCGGGCCTACGGCACGCCAGTGAAGCCCATGACCCCCAAGGTGGTC
ACCCTC---TACCGAGCCCCCGAACTGCTGCTGGGAAGCACCATGCAGACGCCCAGCATCGACATG---GCAGTGGGCTGCATCCTGGCCGAGCTGCTGG
CCCACAAGCCCCTCCTCCCTGGCACTTCTGAGATCCACCAGGTGGACCTGATCGTGCAGCTGCTGGGGACCCCCAGCGAGAACATCTGGCCGGGCTTCTC
CCAGCTGCCGCTGGTCGGCCAGTACAGCCTGCGGAAGCAGCCGTACAACAACCTCAAGCACAAGTTCCCGTGGCTCTCGGAGGCTGGCCTGCGCCTGCTG
AACCTCCTCTTCATGTACGACCCCAAGAAA---GCGACGGCCGGCGACTGCCTGGAGAGCTCCTACTTCAAGGAGAAGCCT------TGCGAGCCGGAGC
TCATGCCCACTTTCCCCCAccATCGCAACAAGCCTGCC---------------------------------------------


>BGISUSP0000896165
MGEPEPESEQIRLKCIRKEGFFTVPPEHR----RSVKEFEKLNRIGEGTYGIV-RARDTQTDEIVALKKVRMDKEK--VPISSLREITLLLRLRHPNIVE
LKEVVVGNHLE-IFLVMGYCEQDLASLLENMPTPFSEAQVKCIVLQVLRGLQYLHQNFIIH----------------------LARAYGTPVKPMTPKVV
TL-YRAPELLLGSTMQTPSIDM-AVGCILAELLAHKPLLPGTSEIHQVDLIVQLLGTPSENIWPGFSQLPLVGQYSLRKQPYNNLKHKFPWLSEAGLRLL
NLLFMYDPKK-ATAGDCLESSYFKEKP--CEPELMPTFPHHRNKPA---------------