Sequences
EST Library Info
jca1Joint capsule
med3Mediastinum
Clusters
Oligos
SNPs

Gene ID ENSG00000149428 (click for geneview)
Transcript ID ENST00000353883(link to ensembl)
Symbol HYOU1
Localtion Chromosome:11:118420110:118433122:-1 band: 11q23.3
Description 150 kDa oxygen-regulated protein precursor (Orp150) (Hypoxia up- regulated 1). [Source:Uniprot/SWISSPROT;Acc:Q9Y4L1]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----------------------------------------------------------------------------------------><--------
-M--A--D--K--V--R--R--Q--R--P--R--R--R--V--C--W--A--L--V--A--V--L--L--A--D--L--L--A--L--S--D--T--L--
ATGGCAGACAAAGTTAGGAGGCAGAGGCCGAGGAGGCGAGTCTGTTGGGCCTTGGTGGCTGTGCTCTTGGCAGACCTGTTGGCACTGAGTGATACACTGG
::::::: :: .::.:.:::::::::::::::::::: : .:::::::::::::.:::::::::::::::::::::::.::::.:: :::   :::::::
ATGGCAGCCATGGTCAAGAGGCAGAGGCCGAGGAGGCTATCCTGTTGGGCCTTGATGGCTGTGCTCTTGGCAGACCTGCTGGCGCTCAGT---ACACTGG
-M--A--A--M--V--K--R--Q--R--P--R--R--L--S--C--W--A--L--M--A--V--L--L--A--D--L--L--A--L--S-----T--L--

------------------------------------------------------------------------------------><--------------
A--V--M--S--V--D--L--G--S--E--S--M--K--V--A--I--V--K--P--G--V--P--M--E--I--V--L--N--K--E--S--R--R--K
CAGTGATGTCTGTGGACCTGGGCAGTGAGTCCATGAAGGTGGCCATTGTCAAACCTGGAGTGCCCATGGAAATTGTCTTGAATAAGGAATCTCGGAGGAA
::::::::::.::::::::::::::.::::::::::::::::::::::::::::::::::::::.:::::.:::::::::      :::::.::::::::
CAGTGATGTCCGTGGACCTGGGCAGCGAGTCCATGAAGGTGGCCATTGTCAAACCTGGAGTGCCTATGGAGATTGTCTTG------GAATCCCGGAGGAA
A--V--M--S--V--D--L--G--S--E--S--M--K--V--A--I--V--K--P--G--V--P--M--E--I--V--L--------E--S--R--R--K

---------------------------------------------------------------><-----------------------------------
--T--P--V--I--V--T--L--K--E--N--E--R--F--F--G--D--S--A--A--S--M--A--I--K--N--P--K--A--T--L--R--Y--F-
AACACCGGTGATCGTGACCCTGAAAGAAAATGAAAGATTCTTTGGAGACAGTGCAGCAAGCATGGCGATTAAGAATCCAAAGGCTACGCTACGTTACTTC
::: ::.::::..::::::::::::::.:::::::::::::::::::::::::::::::::::::: ::.:::::::::::::::::.::.:::::::::
AACCCCAGTGACTGTGACCCTGAAAGAGAATGAAAGATTCTTTGGAGACAGTGCAGCAAGCATGGCCATCAAGAATCCAAAGGCTACACTGCGTTACTTC
--T--P--V--T--V--T--L--K--E--N--E--R--F--F--G--D--S--A--A--S--M--A--I--K--N--P--K--A--T--L--R--Y--F-

----------------------------------------------------------------------------------------------------
-Q--H--L--L--G--K--Q--A--D--N--P--H--V--A--L--Y--Q--A--R--F--P--E--H--E--L--T--F--D--P--Q--R--Q--T--
CAGCACCTCCTGGGGAAGCAGGCAGATAACCCCCATGTAGCTCTTTACCAGGCCCGCTTCCCGGAGCACGAGCTGACTTTCGACCCACAGAGGCAGACTG
:::::.:::::::::::::::: ..:::::::::::::.::::::::: ..:::::.:::::.:::::::::::.. .::::::::::::::::::::::
CAGCATCTCCTGGGGAAGCAGGAGAATAACCCCCATGTGGCTCTTTACAGAGCCCGTTTCCCAGAGCACGAGCTAGGCTTCGACCCACAGAGGCAGACTG
-Q--H--L--L--G--K--Q--E--N--N--P--H--V--A--L--Y--R--A--R--F--P--E--H--E--L--G--F--D--P--Q--R--Q--T--

------------------><---------------------------------------------------------------------------><---
V--H--F--Q--I--S--S--Q--L--Q--F--S--P--E--E--V--L--G--M--V--L--N--Y--S--R--S--L--A--E--D--F--A--E--Q
TGCACTTTCAGATCAGCTCGCAGCTGCAGTTCTCACCTGAGGAAGTGTTGGGCATGGTTCTCAATTATTCTCGTTCTCTAGCTGAAGATTTTGCAGAGCA
::.::::.::.::::::   :::::::::::::::::::::::.:: .: .::::: ::::::::::.:: ::::::::.::::::::.::::::   ::
TGTACTTCCAAATCAGC---CAGCTGCAGTTCTCACCTGAGGAGGTCCTCAGCATGCTTCTCAATTACTCGCGTTCTCTGGCTGAAGACTTTGCA---CA
V--Y--F--Q--I--S-----Q--L--Q--F--S--P--E--E--V--L--S--M--L--L--N--Y--S--R--S--L--A--E--D--F--A-----Q

----------------------------------------------------------------------------------------------------
--P--I--K--D--A--V--I--T--V--P--V--F--F--N--Q--A--E--R--R--A--V--L--Q--A--A--R--M--A--G--L--K--V--L-
GCCCATCAAGGATGCAGTGATCACCGTGCCAGTCTTCTTCAACCAGGCCGAGCGCCGAGCTGTGCTGCAGGCTGCTCGTATGGCTGGCCTCAAAGTGCTG
::::::::::::.:::::::::::::::::::.:::::::::.::::: :::::::::::::::::::::::::: ::.::::::::::::::.::::::
GCCCATCAAGGACGCAGTGATCACCGTGCCAGCCTTCTTCAATCAGGCGGAGCGCCGAGCTGTGCTGCAGGCTGCGCGCATGGCTGGCCTCAAGGTGCTG
--P--I--K--D--A--V--I--T--V--P--A--F--F--N--Q--A--E--R--R--A--V--L--Q--A--A--R--M--A--G--L--K--V--L-

-----------------------------------------------------------------------------><---------------------
-Q--L--I--N--D--N--T--A--T--A--L--S--Y--G--V--F--R--R--K--D--I--N--T--T--A--Q--N--I--M--F--Y--D--M--
CAGCTCATCAATGACAACACCGCCACTGCCCTCAGCTATGGTGTCTTCCGCCGGAAAGATATTAACACCACTGCCCAGAATATCATGTTCTATGACATGG
:::::::::::::::::::: :::::.:::::::::::.:::::::::::: ::::::::::.:::::::: ::::::::.:::::::::::.::.::::
CAGCTCATCAATGACAACACAGCCACCGCCCTCAGCTACGGTGTCTTCCGCAGGAAAGATATCAACACCACAGCCCAGAACATCATGTTCTACGATATGG
-Q--L--I--N--D--N--T--A--T--A--L--S--Y--G--V--F--R--R--K--D--I--N--T--T--A--Q--N--I--M--F--Y--D--M--

------------------------------------------------------------------------------------------------><--
G--S--G--S--T--V--C--T-----I--V--T--Y--Q--M--V--K--T--K--E--A--G--M--Q--P--Q--L--Q--I--R--G--V--G--F
GCTCAGGCAGCACCGTATGCACC---ATTGTGACCTACCAGATGGTGAAGACTAAGGAAGCTGGGATGCAGCCACAGCTGCAGATCCGGGGAGTAGGATT
:: :.:::::::::::.::::::   ::.:::::::::::::..:::::::: :::::  : :::.::::::::::::::::::::::::::      ::
GCGCGGGCAGCACCGTGTGCACCA--ATCGTGACCTACCAGACAGTGAAGACAAAGGACTCGGGGGTGCAGCCACAGCTGCAGATCCGGGGA------TT
G--A--G--S--T--V--C--T--\--I--V--T--Y--Q--T--V--K--T--K--D--S--G--V--Q--P--Q--L--Q--I--R--G--------F

----------------------------------------------------------------------------------------------------
--D--R--T--L--G--G--L--E--M--E--L--R--L--R--E--R--L--A--G--L--F--N--E--Q--R--K--G--Q--R--A--K--D--V-
TGACCGTACCCTGGGGGGCCTGGAGATGGAGCTCCGGCTTCGAGAACGCCTGGCTGGGCTTTTCAATGAGCAGCGCAAGGGTCAGAGAGCAAAGGATGTG
::::::.:::::::::::::::::::::::::::::::: :: ::.:.::::::..::::::::::.::::::::::::::.::::::::.:::::::::
TGACCGCACCCTGGGGGGCCTGGAGATGGAGCTCCGGCTGCGTGAGCACCTGGCCAGGCTTTTCAACGAGCAGCGCAAGGGCCAGAGAGCGAAGGATGTG
--D--R--T--L--G--G--L--E--M--E--L--R--L--R--E--H--L--A--R--L--F--N--E--Q--R--K--G--Q--R--A--K--D--V-

-----------------------------------------------------------------------------------------><---------
-R--E--N--P--R--A--M--A--K--L--L--R--E--A--N--R--L--K--T--V--L--S--A--N--A--D--H--M--A--Q--I--E--G--
CGGGAGAACCCGCGTGCCATGGCCAAGCTGCTGCGTGAGGCTAATCGGCTCAAAACCGTCCTCAGTGCCAACGCTGACCACATGGCACAGATTGAAGGCC
::::::::.:: :::::::::::::::::::::::::::::.:::::.:::::.::.::::: ::.:::::::: :::::::::::::::          
CGGGAGAATCCCCGTGCCATGGCCAAGCTGCTGCGTGAGGCCAATCGACTCAAGACTGTCCTGAGCGCCAACGCAGACCACATGGCACAG----------
-R--E--N--P--R--A--M--A--K--L--L--R--E--A--N--R--L--K--T--V--L--S--A--N--A--D--H--M--A--Q-----------

----------------------------------------------------------------------------------------------------
L--M--D--D--V--D--F--K--A--K--V--T--R--V--E--F--E--E--L--C--A--D--L--F--E--R--V--P--G--P--V--Q--Q--A
TGATGGATGATGTGGACTTCAAGGCAAAAGTGACTCGTGTGGAATTTGAGGAGTTGTGTGCAGACTTGTTTGAGCGGGTGCCTGGGCCTGTACAGCAGGC
        :: :::::.::::::::.::.:::::::: :.:::.:::::::: ::::::::::::::.:::::::::::::: ::.:: ::.::::::::
--------GAGGTGGATTTCAAGGCGAAGGTGACTCGAGCGGAGTTTGAGGACTTGTGTGCAGACTTATTTGAGCGGGTGCCGGGACCGGTGCAGCAGGC
---------E--V--D--F--K--A--K--V--T--R--A--E--F--E--D--L--C--A--D--L--F--E--R--V--P--G--P--V--Q--Q--A

------------------------><--------------------------------------------------------------------------
--L--Q--S--A--E--M--S--L--D--E--I--E--Q--V--I--L--V--G--G--A--T--R--V--P--R--V--Q--E--V--L--L--K--A-
CCTCCAGAGTGCCGAAATGAGTCTGGATGAGATTGAGCAGGTGATCCTGGTGGGTGGGGCCACTCGGGTCCCCAGAGTTCAGGAGGTGCTGCTGAAGGCC
:::::::::::: ::.::::. :::::::::::::::::.::::::::::::::::::::::::::::::::.:.:::.::::::::::::::::::::.
CCTCCAGAGTGCGGAGATGAAACTGGATGAGATTGAGCAAGTGATCCTGGTGGGTGGGGCCACTCGGGTCCCTAAAGTCCAGGAGGTGCTGCTGAAGGCT
--L--Q--S--A--E--M--K--L--D--E--I--E--Q--V--I--L--V--G--G--A--T--R--V--P--K--V--Q--E--V--L--L--K--A-

-------><-------------------------------------------------------------------------------------------
-V--G--K--E--E--L--G--K--N--I--N--A--D--E--A--A--A--M--G--A--V--Y--Q--A--A--A--L--S--K--A--F--K--V--
GTGGGCAAGGAGGAGCTGGGGAAGAACATCAATGCAGATGAAGCAGCCGCCATGGGGGCAGTGTACCAGGCAGCTGCGCTCAGCAAAGCCTTTAAAGTGA
::::::   :::::.:: ::::::::::::::::: ::.::::: ::.::::::::::: :::::::::::.::.:::::::::::::::::.::.::::
GTGGGC---GAGGAACTCGGGAAGAACATCAATGCTGACGAAGCCGCTGCCATGGGGGCCGTGTACCAGGCGGCCGCGCTCAGCAAAGCCTTCAAGGTGA
-V--G-----E--E--L--G--K--N--I--N--A--D--E--A--A--A--M--G--A--V--Y--Q--A--A--A--L--S--K--A--F--K--V--

----------------------------------------><----------------------------------------------------------
K--P--F--V--V--R--D--A--V--V--Y--P--I--L--V--E--F--T--R--E--V--E--E--E--P--G--I--H--S--L--K--H--N--K
AGCCATTTGTCGTCCGAGATGCAGTGGTCTACCCCATCCTGGTGGAGTTCACGAGGGAGGTGGAGGAGGAGCCTGGGATTCACAGCCTGAAGCACAATAA
:::::::::::::::::::::: :::.::::::::::::::::::::::::: ::::::::.:::::::::::::::.::::::::::::::::::::::
AGCCATTTGTCGTCCGAGATGCTGTGATCTACCCCATCCTGGTGGAGTTCACCAGGGAGGTAGAGGAGGAGCCTGGGGTTCACAGCCTGAAGCACAATAA
K--P--F--V--V--R--D--A--V--I--Y--P--I--L--V--E--F--T--R--E--V--E--E--E--P--G--V--H--S--L--K--H--N--K

----------------------------------------------------------------------------------------------------
--R--V--L--F--S--R--M--G--P--Y--P--Q--R--K--V--I--T--F--N--R--Y--S--H--D--F--N--F--H--I--N--Y--G--D-
ACGGGTACTCTTCTCTCGGATGGGGCCCTACCCTCAACGCAAAGTCATCACCTTTAACCGCTACAGCCATGATTTCAACTTCCACATCAACTACGGCGAC
.:: .: ::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::.::.::::::::::::::::::::.::.:::
GCGCATCCTCTTCTCCCGGATGGGGCCCTACCCTCAACGCAAAGTCATCACCTTTAACCGCTACAGCCACGACTTCAACTTCCACATCAACTATGGTGAC
--R--I--L--F--S--R--M--G--P--Y--P--Q--R--K--V--I--T--F--N--R--Y--S--H--D--F--N--F--H--I--N--Y--G--D-

----------------------------><----------------------------------------------------------------------
-L--G--F--L--G--P--E--D--L--R--V--F--G--S--Q--N--L--T--T--V--K--L--K--G--V--G--D--S--F--K--K--Y--P--
CTGGGCTTCCTGGGGCCTGAAGATCTTCGGGTATTTGGCTCCCAGAATCTGACCACAGTGAAGCTAAAAGGGGTGGGTGACAGCTTCAAGAAGTATCCTG
::::::::::::::::::::.::::::   ::::::::::::::::::::::::::.:::::::: ::::: :::::::: :::::::..::::::::.:
CTGGGCTTCCTGGGGCCTGAGGATCTT---GTATTTGGCTCCCAGAATCTGACCACGGTGAAGCTCAAAGGTGTGGGTGAGAGCTTCAGAAAGTATCCCG
-L--G--F--L--G--P--E--D--L-----V--F--G--S--Q--N--L--T--T--V--K--L--K--G--V--G--E--S--F--R--K--Y--P--

-------------------------------------------------------------------><-------------------------------
D--Y--E--S--K--G--I--K--A--H--F--N--L--D--E--S--G--V--L--S--L--D--R--V--E--S--V--F--E--T--L--V--E--D
ACTACGAGTCCAAGGGCATCAAGGCTCACTTCAACCTGGATGAGAGTGGCGTGCTCAGTCTAGACAGGGTGGAGTCTGTATTTGAGACACTGGTAGAGGA
::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::..:::::::::::::::::::::::::::: :::::.:::::
ACTACGAGTCCAAGGGCATCAAGGCTCACTTCAACCTGGATGAGAGCGGCGTGCTCAGCTTAGACAGGGTGGAGTCTGTATTTGAGACTCTGGTGGAGGA
D--Y--E--S--K--G--I--K--A--H--F--N--L--D--E--S--G--V--L--S--L--D--R--V--E--S--V--F--E--T--L--V--E--D

----------------------------><----------------------------------------------------------------------
--S--A--E--E--E--S--T--L--T--K--L--G--N--T--I--S--S--L--F--G--G--G--T--T--P--D--A--K--E--N--G--T--D-
CAGCGCAGAAGAGGAATCTACTCTCACCAAACTTGGCAACACCATTTCCAGCCTGTTTGGAGGCGGTACCACACCAGATGCCAAGGAGAATGGTACTGAT
:::: ::::::::::::::::::: :::   ::::::::::::::.::.::::::::::::::.::..::::::::::.::.::.:::::.::::::::.
CAGCCCAGAAGAGGAATCTACTCTGACC---CTTGGCAACACCATCTCTAGCCTGTTTGGAGGTGGCGCCACACCAGACGCTAAAGAGAACGGTACTGAC
--S--P--E--E--E--S--T--L--T-----L--G--N--T--I--S--S--L--F--G--G--G--A--T--P--D--A--K--E--N--G--T--D-

--------><------------------------------------------------------------------------------------------
-T--V--Q--E--E--E--E--S--P--A--E--G--S--K--D--E--P--G--E--Q--V--E--L--K--E--E--A--E--A--P--V--E--D--
ACTGTCCAGGAGGAAGAGGAGAGCCCTGCAGAGGGGAGCAAGGACGAGCCTGGGGAGCAGGTGGAGCTCAAGGAGGAAGCTGAGGCCCCAGTGGAGGATG
: ::::::::::::.:::::..::::::: :::::.::::::::.::::::::.:::::::..::::::::::::::::: :: . :::....:::::::
AGTGTCCAGGAGGAGGAGGAAGGCCCTGCTGAGGGAAGCAAGGATGAGCCTGGAGAGCAGGCAGAGCTCAAGGAGGAAGCAGACAGCCCGACAGAGGATG
-S--V--Q--E--E--E--E--G--P--A--E--G--S--K--D--E--P--G--E--Q--A--E--L--K--E--E--A--D--S--P--T--E--D--

----------------------------------------------------------------------------------------------><----
G--S--Q--P--P--P--P--E--P--K--G--D--A--T--P--E--G--E--K--A--T--E--K--E--N--G--D--K--S--E--A--Q--K--P
GCTCTCAGCCCCCACCCCCTGAACCTAAGGGAGATGCAACCCCTGAGGGAGAAAAGGCCACAGAAAAAGAAAATGGGGACAAGTCTGAGGCCCAGAAACC
 :::.: .::::::::::::::.::::::::.  ::::.:::::::::::::::::.:::::::.::::: .::::::: :::                 
CCTCCCCACCCCCACCCCCTGAGCCTAAGGGGTCTGCAGCCCCTGAGGGAGAAAAGACCACAGAGAAAGACGATGGGGAAAAG-----------------
A--S--P--P--P--P--P--E--P--K--G--S--A--A--P--E--G--E--K--T--T--E--K--D--D--G--E--K------------------

----------------------------------------------------------------------------------------------------
--S--E--K--A--E--A--G--P--E--G--V--A--P--A--P--E--G--E--K--K--Q--K--P--A--R--K--R--R--M--V--E--E--I-
AAGTGAGAAGGCAGAGGCAGGGCCTGAGGGCGTCGCTCCAGCCCCAGAGGGAGAGAAGAAGCAGAAGCCCGCCAGGAAGCGGCGAATGGTAGAGGAGATC
                :: :::..::::.:.::: :::::::::::::::.:::.:::::::::::::: ::: ::::::.: :::::::.:::::::::
----------------GCCGGGTTTGAGAGTGTCCCTCCAGCCCCAGAGGAAGAAAAGAAGCAGAAGCCAGCCCGGAAGCAGAGAATGGTGGAGGAGATC
-----------------A--G--F--E--S--V--P--P--A--P--E--E--E--K--K--Q--K--P--A--R--K--Q--R--M--V--E--E--I-

-------------------------------------------------------------------><-------------------------------
-G--V--E--L--V--V--L--D--L--P--D--L--P--E--D--K--L--A--Q--S--V--Q--K--L--Q--D--L--T--L--R--D--L--E--
GGGGTGGAGCTGGTTGTTCTGGACCTGCCTGACTTGCCAGAGGATAAGCTGGCTCAGTCGGTGCAGAAACTTCAGGACTTGACACTCCGAGACCTGGAGA
:::::::::::::::::.:::::::::::.:::::::: :::::..:::::::.:. ::.:. :::                                  
GGGGTGGAGCTGGTTGTCCTGGACCTGCCCGACTTGCCCGAGGACGAGCTGGCCCGCTCAGCCCAG----------------------------------
-G--V--E--L--V--V--L--D--L--P--D--L--P--E--D--E--L--A--R--S--A--Q-----------------------------------

-------------------------------------------------------><-------------------------------------------
K--Q--E--R--E--K--A--A--N--S--L--E--A--F--I--F--E--T--Q--D--K--L--Y--Q--P--E--Y--Q--E--V--S--T--E--E
AGCAGGAACGGGAAAAAGCTGCCAACAGCTTGGAAGCATTCATATTTGAGACCCAGGACAAGCTGTACCAGCCCGAGTACCAGGAAGTGTCCACAGAGGA
                                                        :::::::::::::::::::::::::::::::::::::: :::::
--------------------------------------------------------GACAAGCTGTACCAGCCCGAGTACCAGGAAGTGTCCACTGAGGA
---------------------------------------------------------D--K--L--Y--Q--P--E--Y--Q--E--V--S--T--E--E

------------------------------------------------------------------------------><--------------------
--Q--R--E--E--I--S--G--K--L--S--A--A--S--T--W--L--E--D--E--G--V--G--A--T--T--V--M--L--K--E--K--L--A-
GCAGCGTGAGGAGATCTCTGGGAAGCTCAGCGCCGCATCCACCTGGCTGGAGGATGAGGGTGTTGGAGCCACCACAGTGATGTTGAAGGAGAAGCTGGCT
:::::::::::: :::::.:::::.:::::::::.:.:::: ::::::::::::::::::. ::::.:::::::::   ::::::::::::::.::.:::
GCAGCGTGAGGACATCTCCGGGAAACTCAGCGCCACGTCCAGCTGGCTGGAGGATGAGGGCTTTGGGGCCACCACA---ATGTTGAAGGAGAAACTAGCT
--Q--R--E--D--I--S--G--K--L--S--A--T--S--S--W--L--E--D--E--G--F--G--A--T--T-----M--L--K--E--K--L--A-

----------------------------------------------------------------------------------------------------
-E--L--R--K--L--C--Q--G--L--F--F--R--V--E--E--R--K--K--W--P--E--R--L--S--A--L--D--N--L--L--N--H--S--
GAGCTGAGGAAGCTGTGCCAAGGGCTGTTTTTTCGGGTAGAGGAGCGCAAGAAGTGGCCCGAACGGCTGTCTGCCCTCGATAATCTCCTCAACCATTCCA
::::::::::::::::::::::::.::::.::::::::.::.:::::::::::::::::.::::::::::::::::::::.:.:::::::::::::::::
GAGCTGAGGAAGCTGTGCCAAGGGTTGTTCTTTCGGGTGGAAGAGCGCAAGAAGTGGCCTGAACGGCTGTCTGCCCTCGACAGTCTCCTCAACCATTCCA
-E--L--R--K--L--C--Q--G--L--F--F--R--V--E--E--R--K--K--W--P--E--R--L--S--A--L--D--S--L--L--N--H--S--

------------><-----------------------------------------------------------------------------------><-
S--M--F--L--K--G--A--R--L--I--P--E--M--D--Q--I--F--T--E--V--E--M--T--T--L--E--K--V--I--N--E--T--W--A
GCATGTTCCTCAAGGGGGCCCGGCTCATCCCAGAGATGGACCAGATCTTCACTGAGGTGGAGATGACAACGTTAGAGAAAGTCATCAATGAGACCTGGGC
:::::::::::   :::::::::::.::.:::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GCATGTTCCTC---GGGGCCCGGCTTATTCCAGAAATGGACCAGATCTTCACTGAGGTGGAGATGACAACGTTAGAGAAAGTCATCAATGAGACCTGGGC
S--M--F--L-----G--A--R--L--I--P--E--M--D--Q--I--F--T--E--V--E--M--T--T--L--E--K--V--I--N--E--T--W--A

----------------------------------------------------------------------------------------------------
--W--K--N--A--T--L--A--E--Q--A--K--L--P--A--T--E--K--P--V--L--L--S--K--D--I--E--A--K--M--M--A--L--D-
CTGGAAGAATGCAACTCTGGCCGAGCAGGCTAAGCTGCCCGCCACAGAGAAGCCTGTGTTGCTCTCAAAAGACATTGAAGCTAAGATGATGGCCCTGGAC
:::::::::::::::. :::::::::::::.::::: :::::::::::::::::.::::::::::: ::::::::.::.::.:::::::::::.::::::
CTGGAAGAATGCAACCATGGCCGAGCAGGCCAAGCTCCCCGCCACAGAGAAGCCCGTGTTGCTCTCCAAAGACATCGAGGCCAAGATGATGGCTCTGGAC
--W--K--N--A--T--M--A--E--Q--A--K--L--P--A--T--E--K--P--V--L--L--S--K--D--I--E--A--K--M--M--A--L--D-

----------------------------------------------------------------------------------------------------
-R--E--V--Q--Y--L--L--N--K--A--K--F--T--K--P--R--P--R--P--K--D--K--N--G--T--R--A--E--P--P--L--N--A--
CGAGAGGTGCAGTATCTGCTCAATAAGGCCAAGTTTACCAAGCCCCGGCCCCGGCCTAAGGACAAGAATGGGACCCGGGCAGAGCCACCCCTCAATGCCA
:: :::::::::::::::::::::::::::::::::.:::::::::: :::::.::.:::::::::::::: :::::::::::::: ::::::::.::::
CGCGAGGTGCAGTATCTGCTCAATAAGGCCAAGTTTGCCAAGCCCCGCCCCCGACCCAAGGACAAGAATGGCACCCGGGCAGAGCCTCCCCTCAACGCCA
-R--E--V--Q--Y--L--L--N--K--A--K--F--A--K--P--R--P--R--P--K--D--K--N--G--T--R--A--E--P--P--L--N--A--

--------------------------------------><-------------------------------------------------><---------
S--A--S--D--Q--G--E--K--V--I--P--P--A--G--Q--T--E--D--A--E--P--I--S--E--P--E--K--V--E--T--G--S--E--P
GTGCCAGTGACCAGGGGGAGAAGGTCATCCCTCCAGCAGGCCAGACTGAAGATGCAGAGCCCATTTCAGAACCTGAGAAAGTAGAGACTGGATCCGAGCC
::::::::::::::::::: :::::::::::::::                                                                 
GTGCCAGTGACCAGGGGGACAAGGTCATCCCTCCA-----------------------------------------------------------------
S--A--S--D--Q--G--D--K--V--I--P--P------------------------------------------------------------------

----------------------------------------><----------------------------------------------------------
--G--D--T--E--P--L--E--L--G--G--P--G--A--E--P--E--Q--K--E--Q--S--T--G--Q--K--R--P--L--K--N--D--E--L-
AGGAGACACTGAGCCTTTGGAGTTAGGAGGTCCTGGAGCAGAACCTGAACAGAAAGAACAATCGACAGGACAGAAGCGGCCTTTGAAGAACGACGAACTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-->
-*-
TAA
   
---
---

Pig Consensus Sequence

>BGISUST0000896692
ATGGCAGCCATGGTCAAGAGGCAGAGGCCGAGGAGGCTATCCTGTTGGGCCTTGATGGCTGTGCTCTTGGCAGACCTGCTGGCGCTCAGT---ACACTGG
CAGTGATGTCCGTGGACCTGGGCAGCGAGTCCATGAAGGTGGCCATTGTCAAACCTGGAGTGCCTATGGAGATTGTCTTG------GAATCCCGGAGGAA
AACCCCAGTGACTGTGACCCTGAAAGAGAATGAAAGATTCTTTGGAGACAGTGCAGCAAGCATGGCCATCAAGAATCCAAAGGCTACACTGCGTTACTTC
CAGCATCTCCTGGGGAAGCAGGAGAATAACCCCCATGTGGCTCTTTACAGAGCCCGTTTCCCAGAGCACGAGCTAGGCTTCGACCCACAGAGGCAGACTG
TGTACTTCCAAATCAGC---CAGCTGCAGTTCTCACCTGAGGAGGTCCTCAGCATGCTTCTCAATTACTCGCGTTCTCTGGCTGAAGACTTTGCA---CA
GCCCATCAAGGACGCAGTGATCACCGTGCCAGCCTTCTTCAATCAGGCGGAGCGCCGAGCTGTGCTGCAGGCTGCGCGCATGGCTGGCCTCAAGGTGCTG
CAGCTCATCAATGACAACACAGCCACCGCCCTCAGCTACGGTGTCTTCCGCAGGAAAGATATCAACACCACAGCCCAGAACATCATGTTCTACGATATGG
GCGCGGGCAGCACCGTGTGCACcaTCGTGACCTACCAGACAGTGAAGACAAAGGACTCGGGGGTGCAGCCACAGCTGCAGATCCGGGGA------TTTGA
CCGCACCCTGGGGGGCCTGGAGATGGAGCTCCGGCTGCGTGAGCACCTGGCCAGGCTTTTCAACGAGCAGCGCAAGGGCCAGAGAGCGAAGGATGTGCGG
GAGAATCCCCGTGCCATGGCCAAGCTGCTGCGTGAGGCCAATCGACTCAAGACTGTCCTGAGCGCCAACGCAGACCACATGGCACAG-------------
-----GAGGTGGATTTCAAGGCGAAGGTGACTCGAGCGGAGTTTGAGGACTTGTGTGCAGACTTATTTGAGCGGGTGCCGGGACCGGTGCAGCAGGCCCT
CCAGAGTGCGGAGATGAAACTGGATGAGATTGAGCAAGTGATCCTGGTGGGTGGGGCCACTCGGGTCCCTAAAGTCCAGGAGGTGCTGCTGAAGGCTGTG
GGC---GAGGAACTCGGGAAGAACATCAATGCTGACGAAGCCGCTGCCATGGGGGCCGTGTACCAGGCGGCCGCGCTCAGCAAAGCCTTCAAGGTGAAGC
CATTTGTCGTCCGAGATGCTGTGATCTACCCCATCCTGGTGGAGTTCACCAGGGAGGTAGAGGAGGAGCCTGGGGTTCACAGCCTGAAGCACAATAAGCG
CATCCTCTTCTCCCGGATGGGGCCCTACCCTCAACGCAAAGTCATCACCTTTAACCGCTACAGCCACGACTTCAACTTCCACATCAACTATGGTGACCTG
GGCTTCCTGGGGCCTGAGGATCTT---GTATTTGGCTCCCAGAATCTGACCACGGTGAAGCTCAAAGGTGTGGGTGAGAGCTTCAGAAAGTATCCCGACT
ACGAGTCCAAGGGCATCAAGGCTCACTTCAACCTGGATGAGAGCGGCGTGCTCAGCTTAGACAGGGTGGAGTCTGTATTTGAGACTCTGGTGGAGGACAG
CCCAGAAGAGGAATCTACTCTGACC---CTTGGCAACACCATCTCTAGCCTGTTTGGAGGTGGCGCCACACCAGACGCTAAAGAGAACGGTACTGACAGT
GTCCAGGAGGAGGAGGAAGGCCCTGCTGAGGGAAGCAAGGATGAGCCTGGAGAGCAGGCAGAGCTCAAGGAGGAAGCAGACAGCCCGACAGAGGATGCCT
CCCCACCCCCACCCCCTGAGCCTAAGGGGTCTGCAGCCCCTGAGGGAGAAAAGACCACAGAGAAAGACGATGGGGAAAAG--------------------
-------------GCCGGGTTTGAGAGTGTCCCTCCAGCCCCAGAGGAAGAAAAGAAGCAGAAGCCAGCCCGGAAGCAGAGAATGGTGGAGGAGATCGGG
GTGGAGCTGGTTGTCCTGGACCTGCCCGACTTGCCCGAGGACGAGCTGGCCCGCTCAGCCCAG-------------------------------------
-----------------------------------------------------GACAAGCTGTACCAGCCCGAGTACCAGGAAGTGTCCACTGAGGAGCA
GCGTGAGGACATCTCCGGGAAACTCAGCGCCACGTCCAGCTGGCTGGAGGATGAGGGCTTTGGGGCCACCACA---ATGTTGAAGGAGAAACTAGCTGAG
CTGAGGAAGCTGTGCCAAGGGTTGTTCTTTCGGGTGGAAGAGCGCAAGAAGTGGCCTGAACGGCTGTCTGCCCTCGACAGTCTCCTCAACCATTCCAGCA
TGTTCCTC---GGGGCCCGGCTTATTCCAGAAATGGACCAGATCTTCACTGAGGTGGAGATGACAACGTTAGAGAAAGTCATCAATGAGACCTGGGCCTG
GAAGAATGCAACCATGGCCGAGCAGGCCAAGCTCCCCGCCACAGAGAAGCCCGTGTTGCTCTCCAAAGACATCGAGGCCAAGATGATGGCTCTGGACCGC
GAGGTGCAGTATCTGCTCAATAAGGCCAAGTTTGCCAAGCCCCGCCCCCGACCCAAGGACAAGAATGGCACCCGGGCAGAGCCTCCCCTCAACGCCAGTG
CCAGTGACCAGGGGGACAAGGTCATCCCTCCA--------------------------------------------------------------------
----------------------------------------------------------------------------------------------------


>BGISUSP0000896692
MAAMVKRQRPRRLSCWALMAVLLADLLALS-TLAVMSVDLGSESMKVAIVKPGVPMEIVL--ESRRKTPVTVTLKENERFFGDSAASMAIKNPKATLRYF
QHLLGKQENNPHVALYRARFPEHELGFDPQRQTVYFQIS-QLQFSPEEVLSMLLNYSRSLAEDFA-QPIKDAVITVPAFFNQAERRAVLQAARMAGLKVL
QLINDNTATALSYGVFRRKDINTTAQNIMFYDMGAGSTVCTIVTYQTVKTKDSGVQPQLQIRG--FDRTLGGLEMELRLREHLARLFNEQRKGQRAKDVR
ENPRAMAKLLREANRLKTVLSANADHMAQ------EVDFKAKVTRAEFEDLCADLFERVPGPVQQALQSAEMKLDEIEQVILVGGATRVPKVQEVLLKAV
G-EELGKNINADEAAAMGAVYQAAALSKAFKVKPFVVRDAVIYPILVEFTREVEEEPGVHSLKHNKRILFSRMGPYPQRKVITFNRYSHDFNFHINYGDL
GFLGPEDL-VFGSQNLTTVKLKGVGESFRKYPDYESKGIKAHFNLDESGVLSLDRVESVFETLVEDSPEEESTLT-LGNTISSLFGGGATPDAKENGTDS
VQEEEEGPAEGSKDEPGEQAELKEEADSPTEDASPPPPPEPKGSAAPEGEKTTEKDDGEK-----------AGFESVPPAPEEEKKQKPARKQRMVEEIG
VELVVLDLPDLPEDELARSAQ------------------------------DKLYQPEYQEVSTEEQREDISGKLSATSSWLEDEGFGATT-MLKEKLAE
LRKLCQGLFFRVEERKKWPERLSALDSLLNHSSMFL-GARLIPEMDQIFTEVEMTTLEKVINETWAWKNATMAEQAKLPATEKPVLLSKDIEAKMMALDR
EVQYLLNKAKFAKPRPRPKDKNGTRAEPPLNASASDQGDKVIPP--------------------------------------------------------