Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000164707 (click for geneview)
Transcript ID ENST00000354042(link to ensembl)
Symbol SLC13A4
Localtion Chromosome:7:134823268:134870189:-1 band: 7q33
Description Solute carrier family 13, member 4 (Na(+)/sulfate cotransporter SUT- 1). [Source:Uniprot/SWISSPROT;Acc:Q9UKG4]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------------------------------------------------------------------------><
-M--G--L--L--Q--G--L--L--R--V--R--K--L--L--L--V--V--C--V--P--L--L--L--L--P--L--P--V--L--H--P--S--S--
ATGGGCCTGCTGCAGGGCCTGCTCCGAGTCCGGAAGCTGCTGCTGGTCGTCTGCGTCCCGCTCCTGCTGCTGCCTCTGCCCGTCCTCCACCCCAGCAGCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
E--A--S--C--A--Y--V--L--I--V--T--A--V--Y--W--V--S--E--A--V--P--L--G--A--A--A--L--V--P--A--F--L--Y--P
AGGCCTCGTGTGCTTACGTGCTGATCGTGACTGCTGTGTACTGGGTGTCGGAGGCAGTGCCTCTGGGAGCTGCAGCCCTGGTGCCGGCCTTCCTTTACCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------><-----------------------------------------------------------------------
--F--F--G--V--L--R--S--N--E--V--A--A--E--Y--F--K--N--T--T--L--L--L--V--G--V--I--C--V--A--A--A--V--E-
GTTCTTCGGAGTCCTCCGGTCCAATGAGGTGGCGGCGGAGTACTTCAAGAACACCACGCTGCTGCTGGTGGGGGTCATCTGCGTGGCGGCTGCCGTGGAG
                            :::::::: ::.:::::::::::::::::: ::::::::::::: ::::::::::::::::: ::::::::.
----------------------------GTGGCGGCTGAATACTTCAAGAACACCACGATGCTGCTGGTGGGCGTCATCTGCGTGGCGGCAGCCGTGGAA
-----------------------------V--A--A--E--Y--F--K--N--T--T--M--L--L--V--G--V--I--C--V--A--A--A--V--E-

----------------------------------------------------------------><----------------------------------
-K--W--N--L--H--K--R--I--A--L--R--M--V--L--M--A--G--A--K--P--G--M--L--L--L--C--F--M--C--C--T--T--L--
AAGTGGAACCTGCATAAGCGCATTGCTCTGCGCATGGTCTTGATGGCCGGAGCCAAGCCGGGCATGCTGCTGCTCTGCTTCATGTGCTGTACCACGTTGC
::::::::::::::.::::::::::::::::::::::::.:::::::::::::::::::.:::   :::::::::::::::::::::::.:::::: :::
AAGTGGAACCTGCACAAGCGCATTGCTCTGCGCATGGTCCTGATGGCCGGAGCCAAGCCAGGC---CTGCTGCTCTGCTTCATGTGCTGCACCACGATGC
-K--W--N--L--H--K--R--I--A--L--R--M--V--L--M--A--G--A--K--P--G-----L--L--L--C--F--M--C--C--T--T--M--

----------------------------------------------------------------------------------------------------
L--S--M--W--L--S--N--T--S--T--T--A--M--V--M--P--I--V--E--A--V--L--Q--E--L--V--S--A--E--D--E--Q--L--V
TGTCCATGTGGCTGTCCAACACCTCCACCACCGCCATGGTGATGCCCATCGTGGAGGCCGTGCTGCAGGAGCTGGTCAGTGCTGAGGACGAGCAGCTCGT
::::::::::::: :::::::: ::::::::::::::::: ::::::::::::::::::::::::::::::::::::::::: ::::: :::::::::::
TGTCCATGTGGCTCTCCAACACGTCCACCACCGCCATGGTCATGCCCATCGTGGAGGCCGTGCTGCAGGAGCTGGTCAGTGCAGAGGAGGAGCAGCTCGT
L--S--M--W--L--S--N--T--S--T--T--A--M--V--M--P--I--V--E--A--V--L--Q--E--L--V--S--A--E--E--E--Q--L--V

-------------------------------------><-----------------------------------------------------><------
--A--G--N--S--N--T--E--E--A--E--P--I--S--L--D--V--K--N--S--Q--P--S--L--E--L--I--F--V--N--E--E--S--N-
GGCGGGCAACTCCAACACCGAAGAGGCCGAACCCATCAGTCTGGATGTAAAGAACAGCCAACCTTCTCTGGAACTCATCTTTGTCAATGAAGAGTCCAAC
::: :::::: :::.:.:::::::::::::.:.::::   :: .: :..:: :::::::::::.:::::::::::::::::::: ::::::         
GGCCGGCAACGCCAGCGCCGAAGAGGCCGAGCTCATC---CTCAAGGCGAACAACAGCCAACCCTCTCTGGAACTCATCTTTGTGAATGAA---------
--A--G--N--A--S--A--E--E--A--E--L--I-----L--K--A--N--N--S--Q--P--S--L--E--L--I--F--V--N--E----------

-----------------------------><---------------------------------------------------------------------
-A--D--L--T--T--L--M--H--N--E--N--L--N--G--V--P--S--I--T--N--P--I--K--T--A--N--Q--H--Q--G--K--K--Q--
GCAGACCTCACCACTCTGATGCACAACGAGAACCTGAATGGTGTGCCCTCGATCACCAACCCCATCAAAACTGCAAACCAACACCAGGGCAAGAAGCAAC
                              :::::::::::::::::: : .::::::.::::.::::::: ::::::   :::::::.: ::::::..:
------------------------------AACCTGAATGGTGTGCCCACCGTCACCAGCCCCGTCAAAACGGCAAAC---CACCAGGACCAGAAGCGGC
-------------------------------N--L--N--G--V--P--T--V--T--S--P--V--K--T--A--N-----H--Q--D--Q--K--R--

----------><----------------------------------------------------------------------------------------
H--P--S--Q--E--K--P--Q--V--L--T--P--S--P--R--K--Q--K--L--N--R--K--Y--R--S--H--H--D--Q--M--I--C--K--C
ACCCATCCCAGGAAAAGCCACAAGTCCTGACCCCCAGCCCCAGGAAGCAGAAGCTGAACAGAAAGTACAGGTCCCACCATGACCAGATGATCTGCAAGTG
::::..::::::::::::::: ::: ..::::::: : :::::::: :::.:.:: :: :..::.::::.:::::: ::.:::::.::::::::::::::
ACCCGCCCCAGGAAAAGCCACCAGTATCGACCCCCCGACCCAGGAACCAGGAACTCAAAAAGAAATACAAGTCCCAGCACGACCAAATGATCTGCAAGTG
H--P--P--Q--E--K--P--P--V--S--T--P--R--P--R--N--Q--E--L--K--K--K--Y--K--S--Q--H--D--Q--M--I--C--K--C

-----------------------------------------------------------------------------------------------><---
--L--S--L--S--I--S--Y--S--A--T--I--G--G--L--T--T--I--I--G--T--S--T--S--L--I--F--L--E--H--F--N--N--Q-
CCTCTCCCTGAGCATATCCTACTCCGCTACCATTGGCGGCCTGACCACCATCATCGGCACCTCCACCAGCCTCATCTTCCTGGAACACTTCAACAACCAG
::::::::::::::: :::::: :.::.:::::.:: :::::::::::::::::::::::::::::::::::::::::::::::::::::::::      
CCTCTCCCTGAGCATCTCCTACGCTGCCACCATCGGGGGCCTGACCACCATCATCGGCACCTCCACCAGCCTCATCTTCCTGGAACACTTCAAC------
--L--S--L--S--I--S--Y--A--A--T--I--G--G--L--T--T--I--I--G--T--S--T--S--L--I--F--L--E--H--F--N-------

----------------------------------------------------------------------------------------------------
-Y--P--A--A--E--V--V--N--F--G--T--W--F--L--F--S--F--P--I--S--L--I--M--L--V--V--S--W--F--W--M--H--W--
TATCCAGCCGCAGAGGTGGTGAACTTTGGCACCTGGTTCCTCTTCAGCTTCCCCATATCCCTCATCATGCTGGTGGTCAGCTGGTTCTGGATGCACTGGC
                                                            ::::::::::::::::::::::::::::::::::::::::
------------------------------------------------------------CTCATCATGCTGGTGGTCAGCTGGTTCTGGATGCACTGGC
-------------------------------------------------------------L--I--M--L--V--V--S--W--F--W--M--H--W--

---------------><-----------------------------------------------------------------------------------
L--F--L--G--C--N--F--K--E--T--C--S--L--S--K--K--K--K--T--K--R--E--Q--L--S--E--K--R--I--Q--E--E--Y--E
TGTTCCTGGGCTGCAATTTTAAAGAGACCTGCTCTCTGAGCAAGAAGAAGAAGACCAAAAGGGAACAGTTGTCAGAGAAGAGGATCCAAGAAGAATATGA
::::::::::::::                                                                                      
TGTTCCTGGGCTGC--------------------------------------------------------------------------------------
L--F--L--G--C---------------------------------------------------------------------------------------

-----------------><---------------------------------------------------------------------------------
--K--L--G--D--I--S--Y--P--E--M--V--T--G--F--F--F--I--L--M--T--V--L--W--F--T--R--E--P--G--F--V--P--G-
AAAACTGGGAGACATTAGCTACCCAGAAATGGTGACTGGATTTTTCTTCATCCTGATGACCGTACTGTGGTTTACCCGGGAGCCTGGCTTTGTCCCTGGC
                   ::::: ::::::::::::::::::::::::::::::::::: ::.:::::::::::.::::::::::::::::::::.:::
-------------------TACCCTGAAATGGTGACTGGATTTTTCTTCATCCTGATGACAGTGCTGTGGTTTACTCGGGAGCCTGGCTTTGTCCCCGGC
--------------------Y--P--E--M--V--T--G--F--F--F--I--L--M--T--V--L--W--F--T--R--E--P--G--F--V--P--G-

-------------------><-------------------------------------------------------------------------------
-W--D--S--F--F--E--K--K--G--Y--R--T--D--A--T--V--S--V--F--L--G--F--L--L--F--L--I--P--A--K--K--P--C--
TGGGATTCTTTCTTTGAAAAGAAAGGCTACCGTACTGATGCCACAGTCTCTGTCTTCCTTGGCTTCCTCCTCTTCCTCATTCCAGCGAAGAAGCCCTGCT
:::::.::.:::::::::   ::.:::::..:.::.::.::.::::::::..::::::::::::::::::::::.:: ::::::::.::::::::.::.:
TGGGACTCCTTCTTTGAA---AAGGGCTATTGCACCGACGCTACAGTCTCCATCTTCCTTGGCTTCCTCCTCTTTCTGATTCCAGCAAAGAAGCCTTGTT
-W--D--S--F--F--E-----K--G--Y--C--T--D--A--T--V--S--I--F--L--G--F--L--L--F--L--I--P--A--K--K--P--C--

-----------------><---------------------------------------------------------------------------------
F--G--K--K--N--D--G--E--N--Q--E--H--S--L--G--T--E--P--I--I--T--W--K--D--F--Q--K--T--M--P--W--E--I--V
TTGGGAAAAAGAATGATGGAGAGAACCAGGAGCACTCACTGGGGACCGAGCCCATCATCACGTGGAAGGACTTCCAGAAGACCATGCCCTGGGAGATTGT
:..::::::::::::::   :::.::::::::: ::: :.:::::. ::::::::::::::.::::::::::::::::::::::::::.:::::::::::
TCAGGAAAAAGAATGAT---GAGGACCAGGAGCCCTCCCCGGGGATGGAGCCCATCATCACATGGAAGGACTTCCAGAAGACCATGCCTTGGGAGATTGT
F--R--K--K--N--D-----E--D--Q--E--P--S--P--G--M--E--P--I--I--T--W--K--D--F--Q--K--T--M--P--W--E--I--V

------------------------------------------><--------------------------------------------------------
--I--L--V--G--G--G--Y--A--L--A--S--G--S--K--S--S--G--L--S--T--W--I--G--N--Q--M--L--S--L--S--S--L--P-
CATTCTGGTTGGGGGAGGCTATGCTCTGGCTTCTGGTAGCAAGAGCTCTGGCCTCTCTACATGGATTGGGAACCAGATGTTGTCCCTGAGCAGCCTCCCA
:::.::::: ::.:::::::::::::::::::::::.::::::   :::::.:::::.::.::::::::: :::::::::::::.::::::::::: :::
CATCCTGGTGGGAGGAGGCTATGCTCTGGCTTCTGGCAGCAAG---TCTGGTCTCTCCACGTGGATTGGGTACCAGATGTTGTCTCTGAGCAGCCTGCCA
--I--L--V--G--G--G--Y--A--L--A--S--G--S--K-----S--G--L--S--T--W--I--G--Y--Q--M--L--S--L--S--S--L--P-

----------------------------------------------------------------------------------------------------
-P--W--A--V--T--L--L--A--C--I--L--V--S--I--V--T--E--F--V--S--N--P--A--T--I--T--I--F--L--P--I--L--C--
CCGTGGGCTGTCACCCTGCTGGCATGCATCCTCGTGTCCATTGTCACTGAGTTTGTGAGCAACCCAGCAACCATCACCATCTTCCTGCCCATCCTGTGCA
::::::::.::::::::::::::::::::::: ::::::::.::::: ::::::::::::::.::::: :::::::::::::::::::::::::::::::
CCGTGGGCCGTCACCCTGCTGGCATGCATCCTGGTGTCCATCGTCACAGAGTTTGTGAGCAATCCAGCCACCATCACCATCTTCCTGCCCATCCTGTGCA
-P--W--A--V--T--L--L--A--C--I--L--V--S--I--V--T--E--F--V--S--N--P--A--T--I--T--I--F--L--P--I--L--C--

----><----------------------------------------------------------------------------------------------
S--L--S--E--T--L--H--I--N--P--L--Y--T--L--I--P--V--T--M--C--I--S--F--A--V--M--L--P--V--G--N--P--P--N
GCCTGTCTGAAACGCTGCACATTAACCCCCTCTACACCCTGATCCCAGTCACCATGTGCATCTCCTTTGCAGTGATGCTGCCTGTGGGCAATCCCCCTAA
::.:::: ::.:::::::::::.::.:: ::::::::::::::::: ::::::::::::::::::::::::::::::.:::::::::::::.:::::.::
GCTTGTCGGAGACGCTGCACATCAATCCACTCTACACCCTGATCCCTGTCACCATGTGCATCTCCTTTGCAGTGATGTTGCCTGTGGGCAACCCCCCCAA
S--L--S--E--T--L--H--I--N--P--L--Y--T--L--I--P--V--T--M--C--I--S--F--A--V--M--L--P--V--G--N--P--P--N

------------------------------------------><--------------------------------------------------------
--A--I--V--F--S--Y--G--H--C--Q--I--K--D--M--V--K--A--G--L--G--V--N--V--I--G--L--V--I--V--M--V--A--I-
TGCCATCGTCTTCAGCTATGGGCACTGCCAGATCAAAGATATGGTGAAAGCTGGCCTGGGAGTCAACGTTATTGGACTGGTGATAGTAATGGTGGCCATC
.::::::::::::::::::::::::::::::::.:::::::::                     ::.::.::::: :::::::: ::.::::::::::::
CGCCATCGTCTTCAGCTATGGGCACTGCCAGATTAAAGATATG---------------------AATGTCATTGGCCTGGTGATCGTGATGGTGGCCATC
--A--I--V--F--S--Y--G--H--C--Q--I--K--D--M-----------------------N--V--I--G--L--V--I--V--M--V--A--I-

-------------------------------------------------------------------------------->
-N--T--W--G--V--S--L--F--H--L--D--T--Y--P--A--W--A--R--V--S--N--I--T--D--Q--A--*-
AACACCTGGGGAGTTAGCCTCTTCCACCTGGACACTTACCCAGCATGGGCGAGGGTCAGCAACATCACTGATCAAGCCTAA
::.:: :::::..:::.:::::::::::::::::::::.:: :: ::::: :.::::.: :::.::::::::::.::::::
AATACATGGGGGATTAACCTCTTCCACCTGGACACTTATCCCGCCTGGGCTAAGGTCGGGAACGTCACTGATCAGGCCTAA
-N--T--W--G--I--N--L--F--H--L--D--T--Y--P--A--W--A--K--V--G--N--V--T--D--Q--A--*-

Pig Consensus Sequence

>BGISUST0000877898
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------GTGGCGGCTGAATACTTCAAGAACACCACGATGCTGCTGGTGGGCGTCATCTGCGTGGCGGCAGCCGTGGAA
AAGTGGAACCTGCACAAGCGCATTGCTCTGCGCATGGTCCTGATGGCCGGAGCCAAGCCAGGC---CTGCTGCTCTGCTTCATGTGCTGCACCACGATGC
TGTCCATGTGGCTCTCCAACACGTCCACCACCGCCATGGTCATGCCCATCGTGGAGGCCGTGCTGCAGGAGCTGGTCAGTGCAGAGGAGGAGCAGCTCGT
GGCCGGCAACGCCAGCGCCGAAGAGGCCGAGCTCATC---CTCAAGGCGAACAACAGCCAACCCTCTCTGGAACTCATCTTTGTGAATGAA---------
------------------------------AACCTGAATGGTGTGCCCACCGTCACCAGCCCCGTCAAAACGGCAAACCACCAGGACCAGAAGCGGCACC
CGCCCCAGGAAAAGCCACCAGTATCGACCCCCCGACCCAGGAACCAGGAACTCAAAAAGAAATACAAGTCCCAGCACGACCAAATGATCTGCAAGTGCCT
CTCCCTGAGCATCTCCTACGCTGCCACCATCGGGGGCCTGACCACCATCATCGGCACCTCCACCAGCCTCATCTTCCTGGAACACTTCAAC---------
---------------------------------------------------------CTCATCATGCTGGTGGTCAGCTGGTTCTGGATGCACTGGCTGT
TCCTGGGCTGC-----------------------------------------------------------------------------------------
----------------TACCCTGAAATGGTGACTGGATTTTTCTTCATCCTGATGACAGTGCTGTGGTTTACTCGGGAGCCTGGCTTTGTCCCCGGCTGG
GACTCCTTCTTTGAA---AAGGGCTATTGCACCGACGCTACAGTCTCCATCTTCCTTGGCTTCCTCCTCTTTCTGATTCCAGCAAAGAAGCCTTGTTTCA
GGAAAAAGAATGAT---GAGGACCAGGAGCCCTCCCCGGGGATGGAGCCCATCATCACATGGAAGGACTTCCAGAAGACCATGCCTTGGGAGATTGTCAT
CCTGGTGGGAGGAGGCTATGCTCTGGCTTCTGGCAGCAAG---TCTGGTCTCTCCACGTGGATTGGGTACCAGATGTTGTCTCTGAGCAGCCTGCCACCG
TGGGCCGTCACCCTGCTGGCATGCATCCTGGTGTCCATCGTCACAGAGTTTGTGAGCAATCCAGCCACCATCACCATCTTCCTGCCCATCCTGTGCAGCT
TGTCGGAGACGCTGCACATCAATCCACTCTACACCCTGATCCCTGTCACCATGTGCATCTCCTTTGCAGTGATGTTGCCTGTGGGCAACCCCCCCAACGC
CATCGTCTTCAGCTATGGGCACTGCCAGATTAAAGATATG---------------------AATGTCATTGGCCTGGTGATCGTGATGGTGGCCATCAAT
ACATGGGGGATTAACCTCTTCCACCTGGACACTTATCCCGCCTGGGCTAAGGTCGGGAACGTCACTGATCAGGCCTAA


>BGISUSP0000877898
----------------------------------------------------------------------------VAAEYFKNTTMLLVGVICVAAAVE
KWNLHKRIALRMVLMAGAKPG-LLLCFMCCTTMLSMWLSNTSTTAMVMPIVEAVLQELVSAEEEQLVAGNASAEEAELI-LKANNSQPSLELIFVNE---
----------NLNGVPTVTSPVKTANHQDQKRHPPQEKPPVSTPRPRNQELKKKYKSQHDQMICKCLSLSISYAATIGGLTTIIGTSTSLIFLEHFN---
-------------------LIMLVVSWFWMHWLFLGC-----------------------------------YPEMVTGFFFILMTVLWFTREPGFVPGW
DSFFE-KGYCTDATVSIFLGFLLFLIPAKKPCFRKKND-EDQEPSPGMEPIITWKDFQKTMPWEIVILVGGGYALASGSK-SGLSTWIGYQMLSLSSLPP
WAVTLLACILVSIVTEFVSNPATITIFLPILCSLSETLHINPLYTLIPVTMCISFAVMLPVGNPPNAIVFSYGHCQIKDM-------NVIGLVIVMVAIN
TWGINLFHLDTYPAWAKVGNVTDQA*